Integrative Stadtentwicklung - Smart City: Lehrveranstaltungen und Informationen zum Studium

Fakten zum Studium

  • Start: Oktober
  • Kosten pro Semester: € 363,36 Studiengebbühr, € 75,- Kostenbeitrag für Zusatzleistungen, € 19,20 ÖH-Beitrag
  • Präsenzphasen: Dienstags, Mittwochs, Donnerstags jeweils 17:50 - 21:00 plus Fernlehrunterstützung
  • 120 ECTS-Punkte
  • Möglichkeit für ein Auslandssemester

Lehrveranstaltungen

Hier finden Sie die aktuellen Lehrveranstaltungen des Studiengangs. Die Darstellung unterliegt laufenden Aktualisierungen und entspricht nicht zwangsläufig dem Studienplan für das nächste Studienjahr. Module, die sich über mehrere Semester erstrecken, werden jeweils mit der ECTS-Zahl für alle Semester angezeigt. Legende: 

  • kMod kumulatives Modul (jede LV besitzt eine eigene Prüfung)
  • iMod integratives Modul mit abschließender Modulprüfung
  • UE Übung
  • ILV Integrative Lehrveranstaltung
  • SE Seminar
  • LAB Laborstunden
  • TUT Tutorien 

1. Semester

Bezeichnung ECTS
SWS
Modul 11 Ausgleichsmodul (AMOD)
German / kMod
6.00
-
Grundlagen der urbanen Energieversorgung (GUE)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Grundlagen der urbanen Energieversorgung spannen einen Bogen von den Grundbegiffen der Energielehre/des Energiesystems, über den Status des bestehenden städtischen Energiesystems bis hin zu den aktuellen Herausforderungen der urbanen Energieversorgung und der Gebäudetechnik.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • aufbauend auf den Grundbegriffen der Energielehre den aktuellen Status des städtischen Energiesystems zu beschreiben
  • die bauphysikalischen Grundlagen des energieeffizienten Bauens und die gebäudetechnischen Grundlagen in einfachen Beispielen anzuwenden
  • die zukünftigen Herausforderungen des städtischen Energiesystems zu benennen und Lösungsansätze zu skizzieren

Lehrinhalte

  • Grundlagen der Thermodynamik und Energietechnik
  • Grundlagen der konventionellen und erneuerbaren Energietechnologien
  • Energieversorgungskonzepte und Strukturen mit Fokus urbaner Raum
  • Bauphysikalische Grundlagen, Grundlagen der Energieversorgung im Gebäude
  • Energetische Bewertung von Energietechnologien und Gebäuden

Vorkenntnisse

Naturwissenschaftlich-technisch-physikalisches Grundlagenwissen

Literatur

  • Lernplattform E-Genius http://www.e-genius.at
  • Quaschning / Voljer (2015), Regenerative Energiesysteme, Hanser
  • Recknagel / Sprenger / Alber (2015), Taschenbuch für Heizung + Klimatechnik 2015/2016, DIV
  • Konstantin (2013) / Praxisbuch Energiewirtschaft / 3. Auflage, Springer-Vieweg Verlag

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Grundlagen des Verkehrswesens (GVW)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung dient der Einführung in die Themen Mobilität und Verkehr. Die wichtigsten Grundlagen im Bereich der Verkehrsplanung werden mittels Vorlesungen und Übungen vermittelt. Die Lehrveranstaltung wird mit einer schriftlichen Prüfung abgeschlossen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Zusammenhänge von Kenngrößen des Verkehrsablaufs zu beschreiben
  • Verkehrsplanerische Begrifflichkeiten, Dokumente, Analysen zu verstehen und zu hinterfragen
  • gängige Erhebungsmethoden im Verkehrswesen (z.B. Zählungen, Befragungen) sowie deren Anwendungsfelder zu beschreiben
  • gängige Darstellungsformen von Mobilitäts-/Verkehrsdaten zu beschreiben und die Daten zu interpretieren.
  • Grundsätze für die Gestaltung von ÖPNV-Systemen zu erläutern (Basiswissen)
  • den Planungsablauf zu beschreiben und Instrumente zur Beurteilung von Maßnahmen anzuwenden (Basiswissen)
  • Umweltauswirkungen von Verkehr benennen (Basiswissen)
  • Elemente der Querschnittsgestaltung von Straßen zu beschreiben

Lehrinhalte

  • Verkehrsplanung: Grundlagen und Begriffe
  • Verkehrsangebot, Einführung ÖPNV, Verkehrsnachfrage
  • Planungsablauf, Entscheidungshilfen
  • Verkehrserhebungen
  • Verkehrssicherheit
  • Überblick Umweltwirkungen
  • Einführung in die Straßenplanung: Verkehrsablauf auf der freien Strecke, Querschnittsgestaltung von Straßen

Vorkenntnisse

keine

Literatur

  • Höfler, Frank (2006), Verkehrswesen-Praxis, Band 1: Verkehrsplanung, Beuth
  • Höfler, Frank (2006), Verkehrswesen-Praxis, Band 2:: Verkehrstechnik Beuth
  • Winfried, Reinhardt (2012): Öffentlicher Personennahverkehr – Technik – rechtliche und betriebswirtschaftliche Grundlagen, Vieweg+Teubner Verlag-Springer Fachmedien, Wiesbaden GmbH
  • Schnabel, W.; Lohse, D. (2011) Straßenverkehrstechnik, Band 1 und 2
  • Jeweils angegebene Regelwerke (RVS etc.)

Anmerkungen

Moodlekurs beachten

IT Netze und Datenmanagement (ITN)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

In der Lehrveranstaltung lernen die Studierenden die Grundlagen der Netzwerktechnik (kabelgebunden, kabellos) sowie die Grundlagen von relationalen Datenbanken.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • ER Diagramme zu erklären
  • eine Relationale Datenbank mittels SQL zu befüllen, zu verändern und abzufragen
  • die wichtigsten Protokolle das OSI Layer Model inkl. Vor- und Nachteile, zu benennen
  • IPv4- und IPv6-Adressen zu kategorisieren

Lehrinhalte

  • Grundlagen Netzwerktechnik
  • ISO/OSI Modell und Protokolle
  • IP Adressen (IPv4 und IPv6)
  • Domain Name System
  • Definition und Spezifikation relationaler Datenbanken
  • Entwurf semantischer und physikalischer Datenmodelle
  • Datenmodellierung mit ER-Diagrammen
  • Basics in SQL (DDL, DML, DCL)

Vorkenntnisse

keine

Literatur

  • Tanenbaum, Andrew S. / Hübner, C. (2012), Computernetzwerke: Pearson Studium; Auflage: 5., aktualisierte Auflage
  • Elmasri, R.A. / Navathe, S.B. / Shafir, A. (2011): Grundlagen von Datenbanksystemen, Bachelorausg., 3., aktualisierte Aufl., ed, IT - Informatik. Pearson Studium, München
  • Faeskorn-Woyke, H. (Ed.) (2007): Datenbanksysteme: Theorie und Praxis mit SQL2003, Oracle und MySQL, IT - Informatik. Pearson Studium, München.
  • Häckelmann, Heiko. (2013). Kommunikationssysteme: Technik und Anwendungen. Springer
  • Kemper, A. / Eickler, A. (2013): Datenbanksysteme: eine Einführung, 9., erweiterte und aktualisierte Auflage. ed. Oldenbourg verlag, München
Modul 12 Urbane Mobilität (UMOB)
German / kMod
6.00
-
Städtisches Mobilitätsmanagement (SMM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Ausgehend von städtischen verkehrspolitischen Zielsetzungen werden die Instrumente und Herangehensweisen erarbeitet, mit denen die Zielsetzungen erreicht werden können. Augenmerk liegt auf den Handlungsspielräumen der einzelnen Stakeholdern in der Entscheidungshierarchie.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Top-Down Ansätze zu verfolgen um geeignete Maßnahmen und Kombinationen aus Maßnahmen zu verkehrspolitischen Zielsetzungen zu beschreiben
  • Die Wirkung von Mobilitätsmaßnahmen zu beurteilen, um diese als Instrument in der urbanen Verkehrssteuerung gezielt einsetzen zu können
  • Die Wechselwirkung von Maßnahmen und Maßnahmenbündeln beurteilen zu können um effektive Maßnahmenbündel zu beschreiben
  • Die Rolle der Stakeholder in den einzelnen hierarchischen Niveaus der Verkehrspolitik und deren Umsetzung zu analysieren und zu beschreiben
  • Verkehrspolitische Ziele zu analysieren sowie deren Umsetzungsqualität zu beurteilen

Lehrinhalte

  • Hierarchisches Multi-Layer Modell „Politik – Taktik – Maßnahme – Betrieb“
  • Rollen und Verhalten der Akteure im urbanen Mobilitätsmanagement
  • Verkehrspolitische Zielsetzungen und deren Erreichung
  • Bildung von Szenarien als Instrument zur Mobilitätsbeeinflussung
  • Maßnahmen zur Mobilitätsbeeinflussung, deren Wirkung sowie deren Abhängigkeiten in einem Maßnahmen-Mix
  • Die Rolle der Technologie sowie von zukünftigen Anwendungen wie C-ITS
  • Bewertung Wirkung, Zielerreichung und Umsetzungsqualität von Maßnahmen

Vorkenntnisse

keine

Literatur

  • Adamski A., Kwasniak A. (2007): ITS – Hierarchical Multi-Layer System Traffic Safety Option, ITS ILS 2007, ISBN 978-83-88309-86-1
  • Dix, Michelle (2002): The Central London Congestion Charging Scheme – From Conception to Implementation. IMPRINT-EUROPE Thematic Network Seminar, Brussels
  • Europäische Kommission (2013): IVS-Expertengruppe für Urbane Bereiche, Guidlines for ITS deployment in Urban Areas
  • Europäische Kommission (2013): Best Practices in Urban ITS -Collection of Projects
  • ISIS, PWC (2010): Study on Urban Access Restrictions
  • Jesty P., Giezen J., Gaillet J., Durand J., Avontuur V., Bossom R., Franco G., KAREN – European ITS Framework Architecture, Models of Intelligent Transport Systems, KAREN TR 4108, Document Nr. D3.7
  • KU Leuven (2013): UITP, Study on Harmonised Collection of European Data and Statistics in the Field of Urban Transport and Mobility, 2013
  • Leihs, D. (2013): Key Performance Indicators as a Decision Support for Urban Traffic Planning, European ITS Conference Dublin, Ireland, TP0090
  • Leihs, D., Siegl, T., Hartmann, M. (2014): Nutzen und Technologien von Systemen zum Steuern der Zufahrt in urbane Zonen Stadtmaut – Umweltzonen - Zonen mit begrenzter Zufahrt, Springer Vieweg, ISBN 978-3-658-03785-7
  • McLeod, Kenneth; Healy, Seamus (2006): A business management approach to transport – Some lessons learned from congestion charging in Edinburgh. In: European Transport Conference
  • Purd’Homme, Remy; Bocarejo, Juan Pablo. (2005): The London congestion charge: a tentative economic appraisal. In: Transport Policy, Volume 12 Nr.3, S. 279-287
  • Rupprecht Consult GmbH (2012): Leitfaden für nachhaltige urbane Verkehrsplanung
  • Rupprecht Consult GmbH (20013): Pläne für die Nachhaltige urbane Mobilität
  • Siegl, T., Leihs, D., Trapuzzano, A. (2012): Eco Traffic Management in Cities, ITS World Congress Vienna, EU00636

Leistungsbeurteilung

  • Abschlussprüfung
Urbanes Verkehrsaufkommen (UVA)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung gibt einenen Überblick zu den Themen Smart city und motorisierter Verkehr. Dies beinhaltet planerische Aspekte beim motorisierten Individualverkehr und öffentlichen Verkehr, die Diskussion von Auswirkungen und die Beurteilung von Maßnahmen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Grundsätze und Einflussgrößen für die Anwendungsbereiche von Telematik im ÖPNV zu erläutern
  • die Grundlagen, die für die Anwendung im System ÖPNV relevant sind zu beschreiben und deren Relevanz für die Planung zu nennen.
  • mögliche Auswirkungen auf das Gesamtsystem hervorgerufen durch Veränderungen im Verkehrssystem (z.B. durch Einführung einer neuen Verkehrstechnologie oder Straßenbenützungsabgabe) zu erkennen und grob zu analysieren.
  • Möglichkeiten zur Steuerung des ruhenden Verkehrs zu erläutern
  • wesentliche Umweltwirkungen von Straßen(-verkehr) zu benennen
  • Kapazitäten der Verkehrsinfrastruktur baschätzen zu können

Lehrinhalte

  • Betriebliche Grundlagen im ÖPNV
  • Steuerung und Überwachung von ÖPNV-Systemen
  • Fahrgastinformation im ÖPNV
  • Verkehrsinformationssysteme
  • Intermodalität
  • Verkehrswirtschaft
  • Umweltauswirkungen von Verkehr
  • Beurteilung von Verkehrsinfrastrukturprojekten (im Sinne der Nachhaltigkeit) Verkehrsleit- und Informationssysteme
  • Stellplatzmanagement

Vorkenntnisse

Bachelor im Bereich Verkehr/Mobilität oder Ausgleichsmodul Lehrveranstaltung Grundlagen des Verkehrswesens

Leistungsbeurteilung

  • begleitende Übungen in Kleingruppen
  • schriftliche Prüfung
Modul 13 Wahlmodul 1 (WMOD1)
German / kMod
6.00
-
Modul 13a AK1 - Urbaner Gebäudebestand (AK13a)
German / kMod
6.00
-
Energetische Quartierssanierung (AK1EQS)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Grundlagen in der räumlichen und energetischen Analyse von urbanen Quartieren; Einflussfaktoren der Rahmenbedingungen auf den Energieverbrauch; Methodische Ansätze zur Erstellung von energetischen Sanierungskonzepten im urbanen Raum

Methodik

Integrierte LV, Vorträge, Gruppenarbeit

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Sanierungspotentiale im Gebäudebestand zu analysieren
  • Energetische Sanierungsvarianten für die Quartierssanierung zu definieren

Lehrinhalte

  • Bedarfsanalysen des Gebäudebestands
  • Energierelevante Maßnahmenbündel für unterschiedliche Gebäudetypologien
  • Sanierungskonzepte für Quartiere

Vorkenntnisse

Grundlagen und Definition von Smart City Einflussfaktoren Team-Work Kompetenzen Grundlagen des wissenschaftlichen Arbeitens

Literatur

  • Literatur / Referenzen werden in den Unterrichtseinheiten zur Verfügung gestellt

Leistungsbeurteilung

  • 50% Gruppenarbeit / 50% Abschlussprüfung
Nachverdichtung im urbanen Raum (AK1NUR)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Integrative Stadtentwicklung im Sinne einer Smart City funktioniert nur in einer sinnvollen Kombination zwischen planerischen Konzepten und technischen Lösungen. Ein stadtplanerisches Konzept stellt die Nachverdichtung urbaner Strukturen dar. Die bereits gebaute Stadt bietet in baulich-räumlicher Sicht große Potentiale zur Energieeinsparung. Wie diese Potentiale durch strategische Konzepte, konkrete Umsetzungsansätze und passend auf den jeweiligen Stadtraum erfolgreich umgesetzt werden kann, wird in dieser Lehrveranstaltung behandelt. Besonderes Augenmerk wird auf die vorhandenen städtebaulichen Strukturen und die energiesparende Quartiersplanung an sich gelegt. Es werden bestehende Stadtmorphologien verglichen und bestehende Konzepte zur Nachverdichtung behandelt sowie eigene Gedanken dazu formuliert.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Einflussfaktoren der Stadtmorphologie auf den urbanen Energieverbrauch zu beschreiben
  • Nachverdichtungskonzepte im urbanen Raum zu vergleichen und ein eigenes Konzept zu erstellen

Lehrinhalte

  • Auswirkung der Stadtmorphologie auf den urbanen Energieverbrauch
  • Gebäudetypologien im urbanen Kontext
  • Zielsetzungen und Maßnahmen zur Nachverdichtung

Vorkenntnisse

keine

Leistungsbeurteilung

  • Literaturstudium und anschließende Präsentation in der Lehrveranstaltung
  • Seminarabschlussarbeit

Anmerkungen

Die zu erbringenden Leistungen werden in Gruppenarbeit erstellt.

Modul 13b AK1 - Trends der urbanen Energieversorgung (AK13b)
German / iMod
6.00
-
Trends der urbanen Energieversorgung (AK1TUE)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung baut auf die Grundlagenvorlesung der urbanen Energieversorgung auf und vertieft Inhalte in den Bereichen der urbanen, erneuerbaren Energietechnologien und Energieversorgung von Gebäuden und Stadtquartieren. Erweiternd wird auf regulatorische Rahmenbedingungen, Wirtschaftlichkeitsaspekte und Lebenszykusbetrachtungen, sowie auf Fragestellungen der sozialen Akzeptanz eingegangen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • ein ganzheitliches Verständnis für energierelevante Fragestellungen im städtischen Raum zu entwickeln und anhand von beispielhaften Projekten umzusetzen
  • neue Technologieentwicklungen und veränderte Rahmenbedingungen in Bezug auf deren Auswirkungen in städtischen Strukturen zu bewerten
  • Gesellschaftliche und soziale Aspekte in zukünftigen Energiesystemen zu bewerten und die Anforderungen unterschiedlicher Interessensgruppen entsprechend einzuordnen
  • Wirtschaftlichkeits- und Lebenszyklusbetrachtungen von ausgewählten Energie-Projekten durchzuführen

Lehrinhalte

  • Strategien und Trends der städtischen Energieversorgung
  • Herausforderungen beim Umbau zu einer erneuerbaren städtischen Energieversorgung
  • Rechtliche und regulatorische Rahmenbedingungen
  • Wirtschaftlichkeits- und Lebenszyklusbetrachtungen von ausgewählten Projekten
  • Fragestellungen der sozialen Akzeptanz und Diversitätsaspekte

Vorkenntnisse

Grundlagen der urbanen Energieversorgung

Literatur

  • Cave / Cochrane, et.al. (2014), Mapping Smart Cities in the EU
  • Droege (2011): Urban Energy Transition: From Fossil Fuels to Renewable Power, Elsevier Verlag
  • Morata / Sandoval (2012): European Energy Policy: An Environmental Approach, Edward Elgar Publishing
  • Tagungsband Smart City Week 2015

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Modul 13c AK1 - Physikalische Messtechnik (AK13c)
German / iMod
6.00
-
Physikalische Messtechnik für Smart Cities (AK1PMT)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung zeigt Möglichkeiten der Messung physikalischer Größen, die im Smart City Umfeld benötigt werden.

Methodik

Vorlesung mit integrierten Übungsanteilen, Labor und Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Messgrößen, die in der Smart-Cities-Thematik von besonderer Bedeutung sind, physikalisch und statistisch korrekt aufzunehmen
  • Messwerte statistisch korrekt zu verarbeiten und auszuwerten. in gegebenen praktischen Situationen geeignete Messmethoden auszuwählen und diese anzuwenden
  • die Bedeutung von Messfehlern und deren Auswirkungen zu beurteilen
  • Messfehler für physikalische Messgrößen aus Toleranzen von Messgeräten zu bestimmen

Lehrinhalte

  • Struktur einer Messeinrichtung
  • Systematische und statistische Messfehler
  • Fehlerfortpflanzung
  • Messverfahren für Temperatur
  • Messverfahren für Energie
  • Messverfahren für Leistung
  • Messverfahren für Wärmemengen
  • Messverfahren für Umweltgrößen
  • Messverfahren für Licht
  • Auswerte-Methoden für Messgrößen

Vorkenntnisse

Grundlagen der Physik und Elektrotechnik

Literatur

  • Kunze, H.J. (1986): Physikalische Messmethoden, Teubner
  • Lerch, R. (2007): Elektrische Messtechnik: Analoge, digitale und computergestütze Verfahre, Springer
  • Lindner, G. / Niebuhr, J (2001): Physikalische Messtechnik mit Sensoren, Oldenbourg
  • Versuchsanleitungen
Modul 13d AK1 - Embedded Systems (AK13d)
German / iMod
6.00
-
Embedded Systems (AK1ES)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Einführung in das hardwarenahe Programmieren von Mikrocontrollern.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Eigenschaften und Besonderheiten von Embedded Systems zu beschreiben
  • eine Integrierte Entwicklungsumgebung für das Programmieren und Debuggen von Embedded Systems Software einzusetzen
  • hardwarenahe modulare Software in C für Embedded Systems zu entwerfen und zu schreiben
  • typische Peripherieeinheiten eines Mikrocontrollers für die Anbindung von Sensoren und Aktoren einzusetzen

Lehrinhalte

  • Aufbau, Eigenschaften und Besonderheiten von Embedded Systems
  • Aufbau und Funktion von Mikrocontrollern
  • Arbeiten mit einer Integrierten Entwicklungsumgebung für Mikrocontroller
  • Debugging von Embedded Systems Software
  • Softwareentwurf in C für Embedded Systems, modulare Software
  • Zugriff auf I/O-Ports, Bit-Manipulation in C
  • Behandlung von Ereignissen in Interrupt Service Routinen
  • Timer/Counter-Einheit
  • Serielle digitale Interfaces (z.B. RS232, SPI, I2C)
  • weitere Peripherieeinheiten (z.B. ADC, PWM, DMA, ...)
  • Projektarbeit

Vorkenntnisse

Programmiersprache C

Literatur

  • Skriptum C167, C167 User Manual, Studienbriefe, Simulationstool
  • Valvano, J. (2012): Embedded Systems: Introduction to Arm Cortex-M Microcontrollers, CreateSpace Independent Publishing Platform; 5th edition
  • White, E. (2011): Making Embedded Systems: Design Patterns for Great Software, O'Reilly Media; 1st edition

Leistungsbeurteilung

  • schriftlicher Test, Projektarbeit im Team
Modul 13e AK1 - Human Factors in der Mobilität (AK13e)
German / kMod
6.00
-
Faktor Mensch in der Mobilität (AK1HUM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Diese Vorlesung befasst sich mit den menschlichen Faktoren, die das Mobilitätsverhalten der VerkehrsteilnehmerInnen beeinflussen. Daraus werden Kenntnisse über verschiedene Ansätze zur besseren Nutzung der Stadtinfrastruktur und Transportsysteme gewonnen. Ebenso werden die Auswirkungen der Einführung neuer Technologien im Fahrerverhalten berücksichtigt.

Methodik

Vorlesung mit integrierten Übungsanteilen, Gruppenarbeit und Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • menschliche Faktoren, die den Verkehr beeinflussen, zu beschreiben
  • Mobilitätsprobleme zu analysieren und potentielle Lösungen vorzuschlagen
  • Faktoren, die menschliche Mobilität beeinflussen, zu spezifizieren
  • Methoden zur Datenerfassung und -verarbeitung auf der Grundlage geeigneter Technologien und des spezifischen Anwendungsfalles zu entwerfen

Lehrinhalte

  • Menschliche Faktoren, die Intelligente Verkehrssysteme beeinflussen
  • Methoden, die menschlichen Faktoren für eine intelligente Mobilität berücksichtigen.
  • Faktoren, die die Mobilität der Menschen beeinflussen

Vorkenntnisse

Grundlagen des Verkehrswesens

Literatur

  • Understanding individual human mobility patterns, MC Gonzalez, CA Hidalgo, AL Barabasi, Nature 453 (7196), 779-782
  • The ‘Roadmap to a Single European Transport Area - Towards a competitive and resource efficient transport system’, http://ec.europa.eu/transport/strategies/2011_white_paper_en.htm
  • The Human Factors of Transport Signs, edited by Candida Castro,Tim Horberry https://books.google.at/books?id=iFCZ53i5XXgC&printsec=frontcover&dq=human+factors+in+transport&hl=de&sa=X&ved=0ahUKEwiN5ov-vdfOAhVBaRQKHSEtAOYQ6AEIODAA#v=onepage&q=human%20factors%20in%20transport&f=false
  • Human Factors in Intelligent Transportation Systems, Woodrow Barfield, ‎Thomas A. Dingus – 2014; https://books.google.at/books?isbn=1317781104

Leistungsbeurteilung

  • Präsentationen, Gruppenarbeit, Prüfung
Verkehrssicherheit (AK1VSICH)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung soll einen Überblick über die Grundlagen der Straßenverkehrssicherheitsarbeit vermitteln. Darauf aufbauend werden mit den Studierenden anhand zahlreicher praktischer Beispiele konkrete Maßnahmen und deren Wirkungen diskutiert.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Wirkung von (vorrangig technischen) Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt grob abzuschätzen
  • Forschungsmethoden aufzuzählen und zu erklären, die für die genaue Feststellung der Wirkungen von Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt zur Verfügung stehen
  • Datenquellen aufzuzählen und zu erklären, die bei der Feststellung der Wirkung von Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt benutzt werden können
  • verschiedene Methoden der Priorisierung von Maßnahmen zu nennen und deren Vor- und Nachteile zu beschreiben
  • typische Verhaltensweisen von Menschen im Straßenverkehr aufzuzählen und zu erläutern, anhand derer der Umgang von Verkehrsteilnehmern mit unterschiedlichen Maßnahmen erklärt werden kann
  • für Teilbereiche der Verkehrssicherheitsarbeit (z.B. für Verkehrsteilnehmergruppen) vertieft spezifische Probleme zu identifizieren und Maßnahmen vorzuschlagen

Lehrinhalte

  • Überblick über das Verkehrsgeschehen in Österreich und auf Europäischer Ebene
  • Quantifizierung des Unfallgeschehens: Datenerfassung, Datenspeicherung, Datenauswertung
  • Aspekte des Verhaltens von Verkehrsteilnehmern
  • Methoden der Verhaltensforschung bei Verkehrsteilnehmern
  • Datenquellen für Sicherheits-, Verkehrs- und Umweltdaten
  • Methoden der Priorisierung von Maßnahmen auf integrierter Basis von Sicherheits-, Verkehrs- und Umweltdaten

Vorkenntnisse

keine erforderlich

Literatur

  • Elvik, R. / Hoye, A. / Vaa, T. / Sorensen, M. (2009): The Handbook of Road Safety Measures, 2nd Edition, Emerald Publishing Group Limited, ISBN 978-1-84855-250-0
  • European Road Safety Observatory www.erso.eu
  • Herry et al (2007): Unfallkostenrechnung Straße 2007, Forschungsarbeiten aus dem Verkehrswesen Band 177, Bundesministerium für Verkehr, Innovation und Technologie, Wien
  • Höhnscheid et al (2005): ROSEBUD: Framework for Efficiency Assessment, Handbook of Assessed Road Safety Measures; Demonstration Course, Bergisch-Gladbach. www.rosebud-eu.org.
  • OECD/ECMT (2006): Speed Management. ISBN 92-821-0377-3 Robatsch, K. / Schrammel, E. (2001): Grundlagen der Verkehrssicherheit. IVS-Schriftenreihe, Band 13. TU-Wien
  • SUPREME Final Report Part C: Handbook For Measures At The Country Level, KFV, 2007
  • SUPREME Final Report Part D: Handbook For Measures At The European Level

Leistungsbeurteilung

  • schriftliche Prüfung
  • eine schriftliche Seminararbeit
  • sowie LV-immanent (aktive Mitarbeit)
Modul 13f AK1 - Treibhausgasreduktion (AK13f)
German / iMod
6.00
-
Treibhausgasreduktion (AK1THGR)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung zegt die Arten und Ansätze zur Vermeidung von Treibhausgasen, es wird auch auf die rechtlichen Aspekte eingegangen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Quellen von Treibhausgasen in Städten mit Hinblick auf ihr Emissionsverhalten zu beurteilen
  • die Interdependenzen unterschiedlicher Emissionsquellen zu bewerten
  • die Maßnahmen zur Verringerung von Treibhausgasen zu beurteilen
  • die nationalen Verpflichtungen zum Erreichen von Emissionszielen mit Hinblick auf supranationale, nationale und regionale Maßnahmen zu bewerten

Lehrinhalte

  • Wirkung und Arten von Treibhausgasen
  • Internationale Vereinbarungen und Bestrebungen zur THG-Verringerung
  • Quellen von Treibhausgasen sowie deren Trend
  • Lokale Maßnahmen zum Verringern von Treibhausgasen in Städten, insbesondere Heizung, industrielle Prozesse und Mobilität
  • Interdependenz von Maßnahmen zur THG-Verringerung

Vorkenntnisse

keine

Literatur

  • Climate Change 2013, The Physical Science Basis, Cambridge University Press
  • Europäische Kommission (2014): Klimaschutz, ISBN 978-92-79-41340-7
  • Europäische Kommission (2014): Conclusion EUCO 169/14
  • Europäische Kommission (2013): The EU Emission Trading System (EU ETS), 2013
  • European Commission (2012): Richtlinie des Europäischen Parlamentes und des Rates, Nr. 2012/27/EU („Energieeffizienzrichtlinie“)
  • Europäische Kommission (2011): Weissbuch - Fahrplan zu einem einheitlichen europäischen Verkehrsraum – Hin zu einem wettbewerbsorientierten und ressourcenschonenden Verkehrssystem: KOM(2011) 144 endgültig
  • KU Leuven, UITP (2013): Study on Harmonised Collection of European Data and Statistics in the Field of Urban TraCnsport and Mobility
  • Umweltbundesamt (21013):Klimaschutzbericht 2013
  • Umweltbundesamt (2015): GHG Projections and Assessment of Policies and Measures in Austria, 2015
  • UN (2014): UN Climate Summit 2014, Cities Mayors Compact Action Statement
  • UN (1998): UN Kyoto Protocol to the United Nations Framework Convention on Climate Change
Modul 14 Projekt 1 (PRJ1)
German / kMod
6.00
-
Interdisziplinäre Teamarbeit (ITEAM)
German / SE
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung vermittelt den Studierenden theoretische Kenntnisse zur interdisziplinären Teamarbeit und bereitet sie darauf vor diese im beruflichen Kontext umzusetzen. Die persönliche Reflexion, das Behandeln von Fallbeispielen und das Üben von Verhaltensmöglichkeiten stehen im Mittelpunkt.

Methodik

Vorlesung mit integrierten Übungsanteilen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Kommunikationsverhalten in interdisziplinären Gesprächen anhand theoretischer Erkenntnisse (z.B. unterschiedliche Überzeugungen, Hierarchien und Professionszentrismus) zu beschreiben und zu erläutern.
  • konkrete Verhaltensalternativen für eine erfolgreiche Zusammenarbeit in interdisziplinären Teams (z.B. Perspektivenwechsel, Sprachanpassung, mediatorische Gesprächsführung) fallbezogen zu entwickeln und in einfachen Übungen anzuwenden
  • Arten, Ursachen und die verschiedenen Stufen eines Konfliktes insbesondere in einem interdisziplinären Kontext (z. B. nach dem Eskalationsmodell von Glasl) zu beschreiben und Instrumente der Deeskalation (z. B. Selbsthilfe, Moderation) anzuwenden.

Lehrinhalte

  • Multi-, Inter- und Transdisziplinarität
  • Herausforderungen in der interdisziplinären Teamarbeit
  • Kriterien und Kompetenzen für erfolgreiche interdisziplinäre Teamarbeit
  • Identität und Selbstkonzept
  • Überblick zu Theorien der Gruppendynamik
  • Kommunikation und Gesprächsführung
  • Grundlagen zur konstruktiven Gestaltung von Konfliktsituationen

Vorkenntnisse

keine

Literatur

  • Glasl, Friedrich (2008): Selbsthilfe in Konflikten, 5. Auflage, Stuttgart: Verlag Freies Geistesleben/Haupt
  • Haeske, U. (2008): Teamentwicklung, Berlin: Cornelsen Verlag, [bilingual book: in English and German]
  • Simon, Walter (2007): GABALs großer Methodenkoffer: Grundlagen der Kommunikation, Offenbach: Gabal Verlag
  • weitere Literatur zu interdisziplinären Teams

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Prüfung (Note)

Anmerkungen

keine

Projektarbeit 1 (PRJ1)
German / PRJ
3.00
2.00

Kurzbeschreibung

Analyse und Spezifikation eines Projekts im (interdisziplinären) Smart City Umfeld

Methodik

Projektseminar

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • anhand einer Problemstellung einen State of the art Bericht zu erstellen und eine Marktanalyse durchzuführen
  • Anwendungsszenarien und funktionale Anforderungen zu definieren
  • Vision, Beschreibung, Ziele und Projektumfeld zu formulieren und eine erste Version eines Projekthandbuches zu erstellen
  • Resultate in Form eines wissenschaftlichen Papers darzustellen

Lehrinhalte

  • Umsetzung von Projekten in Teamarbeit (nach Möglichkeit mit einer interdisziplinären Teamzusammenstellung)
  • Führen eines Projekthandbuchs
  • State of the art Analyse (wissenschaftlich, technisch)
  • Marktanalyse
  • Definition von Anwendungsszenarien (inklusive organisatorischer Rahmenbedingungen)
  • Funktionale Anforderungen
  • Projektmanagement

Vorkenntnisse

Grundlegendes Verständnis von Projektmanagement, technische Vorkenntnisse je nach Projektthema

Literatur

  • Abhängig vom Projektthema

Leistungsbeurteilung

  • LV-Immanent, Documentation, Präsentationen, Paper
Modul 15 Smart City Perspektive (SCP)
German / kMod
6.00
-
Smart City Trends (SCT)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Es wird der Zusammenhang von Smart-City-Konzepten, den hierbei entstehenden Berufsfeldern und den künftig dafür notwendigen Kernaufgaben und Kerntätigkeiten erläutert. Berufliche Kernkompetenzen für die beruflichen Positionen und Funktionen zur Ermöglichung einer integrativen Stadtentwicklung werden anhand des Smart City Konzeptes schriftlich mit den Studierenden ausgearbeitet und beurteilt.

Methodik

Vorlesung mit integrierten Übungsanteilen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • unterschiedliche Smart-City-Konzepte darlegen und auf ihre sozio-technologische Ausgewogenheit hin einordnen zu können
  • einen Überblick über die Berufsfelder im Kontext des Smart City Ansatzes darlegen und auf ihre künftigen Entwicklungen hin analysieren zu können
  • Kernkompetenzen integrativer Stadtentwicklung zu definieren und auf horizontale Schnittstellenanforderungen zu übertragen
  • Berufsbilder für Positionen und Funktionen im Kontext eines Smart City Konzeptes schriftlich ausarbeiten zu können

Lehrinhalte

  • Konzepte des Smart City Ansatzes sowie urbane Systemarchitekturen
  • Berufsfeldmodelle zur Analyse beruflicher Smart City Trends
  • Berufsfelder im Rahmen von Smart City mit dem integrativen Fokus von Mobilität – Energie - IKT
  • integrative Kernkompetenzen für den Aufbau bzw. die Stabilisierung von Smart-City-Projekten
  • Ausarbeitung bzw. Adaption von (bestehenden) Berufsbildern/ Stellenprofilen hin zur Weiterentwicklung von Smart-City-affinen Tätigkeitsfeldern (Arbeitsplätzen)

Vorkenntnisse

keine

Literatur

  • Guenter Essl (2015). The ‘profession/ occupation field model’ as an activity theoretical framework for the development of engineers in the context of the Smart City approach. http://authors.elsevier.com/sd/article/S1877042815047515
  • Etezadzadeh (2015). Smart City - Stadt der Zukunft? - Die Smart City 2.0 als lebenswerte Stadt und Zukunftsmarkt (essentials). (1st ed.): Springer Vieweg
  • Jaekel, M. (2015). Smart City wird Realität. (1. Aufl. 2015): Springer Vieweg.
  • Stögerer, M., Müller, J., & Jutz, K. (2015). Smart City. Kritische Analyse des Konzepts: Grin Verlag.
  • Stroschein, C. (Ed.) (2014). Smart City: Die Zukunft der Stadt Trends und Entwicklungen. (1., Aufl.): Beuth.

Leistungsbeurteilung

  • Additive Aufgabenstellungen über das Gesamtsemester hinweg
Stadtprozesse (SPZ)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Ausgehend von einer Einführung in das Standortproblem werden unterschiedliche theoretische Ansätze angerissen. Zum einen solche, die die Transportkosten in den Vordergrund stellen (neoklassische), zum anderen auch jüngere Ansätze, die stärker die Rolle von Arbeitskräften, Information sowie von Organisation und Technologie betonen. Das Zusammenwirken von beteiligten Akteuren wird beleuchtet, zusätzlich werden die Strukturen der Bodennutzung innerhalb von Städten als auch das gesamte städtische System beleuchtet. Es erfolgt eine Darstellung der organisatorischen, rechtlichen und technischen Rahmenbedingungen der elektronischen Wechselwirkung zwischen Behörden einerseits und Unternehmen bzw. Bürgern andererseits.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Grundlegende Prinzipien nachhaltiger Stadtökonomie erklären und diskutieren
  • Prinzipien und Strategie des österreichischen E-Government benennen
  • Einflussfaktoren auf die Standortwahl identifizieren und quantifizieren
  • Stakeholder und ihre Interessen analysieren

Lehrinhalte

  • Grundlagen der Stadtökonomie: Bildung, Sicherheit, Wohnungsmarkt, Nutzbarkeit des öffentlichen Raums, Umweltschutz
  • Urban Governance: Stadtpolitik, Bürgerrechte, Verwaltungsökonomie
  • E-Government, Prozesse und Realisierungen
  • Städtische Stakeholderprozesse

Vorkenntnisse

keine

Literatur

  • Amey, F. / Ringel, J. (2014): Hotspots der Stadtentwicklung: Methoden, Praxis und Perspektiven der gemanagten Stadt
  • Hentze, J. / Thies, B. (2014): Stakeholder-Management und Nachhaltigkeits-Reporting
  • Plattform Digitales Österreich, https://www.digitales.oesterreich.gv.at
  • Ruby, I. / Ruby, A. (2014): The Economy of Sustainable Construction, Ruby Press
  • Van Der Heijden, J. (2014): Governance for Urban Sustainability and Resilience: Responding to Climate Change and the Relevance of the Built Environment, Edward Elgar Publishing Ltd
  • Maier, G./Tödtling, F. (2006): Regional- und Stadtökonomik

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung (Ausarbeitung und Präsentation)

2. Semester

Bezeichnung ECTS
SWS
Modul 21 Urbane Erneuerbare Energie (AMOD)
German / kMod
6.00
-
Energieinfrastruktur (EINF)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die grundlegenden Auslegungsgrößen einer Energieversorgungsinfrastruktur werden am Beispiel eines Fernwärmenetzes vermittelt. Das Stromnetz mit seiner steigenden Bedeutung als Energieträger wird genauer in seiner aktuellen Entwicklung hin zu einem Digitalen Netz beleuchtet und die Modellierung im Smart Grid Architektur Modell vermittelt.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die grundlegenden Parameter zur Auslegung einer Energieinfrastruktur zu kennen und abzuleiten
  • die Struktur der zukünftigen Strominfrastruktur zu beschreiben (Smart Grids Architektur Modell), exemplarische Anwendungsfälle und Rollen sowie betriebliche Rahmenbedingungen zu kennen

Lehrinhalte

  • Auslegung einer Fernwärmeversorgung
  • Komponenten des elektrischen Stromnetzes
  • Struktur des Strommarktes, Entbündelung
  • Aktuelle Herausforderungen im Detail
  • Smart Grids Architektur Modell (SGAM)

Vorkenntnisse

Naturwissenschaftlich- technisch-physikalisches Grundlagenwissen

Literatur

  • Das Österreichische Strommarktmodell, E-Control, 2013
  • Berger et.al. (2014), Smart Grid Technologie Roadmap
  • Richtlinie 2009/72/EG DES EUROPÄISCHEN PARLAMENTS UND DES RATES vom 13. Juli 2009 über gemeinsame Vorschriften für den Elektrizitätsbinnenmarkt
  • CEN - CENELEC - ETSI Smart Grid Coordination Group - Smart Grid Reference Architecture
  • Smart Grid Standards Map, IEC International Electrotechnical Commission

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Energieversorgung von Gebäuden und Quartieren (EGQ)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Energieversorgung von Gebäuden und Quartieren wird in den wesentlichen Systemlösungen dargestellt. Es werden die wesentlichen Einflussfaktoren und Maßnahmen bearbeitet: Komfort-Energiebedarf-Energiedeckung, Status Quo - Best Practice; Bestandssanierung-Neubau; Wohnen-Büro-Bildung; Nutzenergieabgabe, Energieverteilung, Energieeffiziente Systeme, konventionelle und erneuerbare Systeme. Im Mittelpunkt stehen energieautonome, bzw. CO2-neutrale Versorgungskonzepte. Diese werden anhand eines Übungsbeispiel im urbanen Bestand verdeutlicht: Mehrfamilienhaus nachverdichtet im Gründerzeitquartier

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Energieeffiziente Versorgungsstrukturen für Gebäude und Gebäudekomplexe entwerfen und deren ökologische Belastung (z.B. PEB, THG) in der Betriebsphase vereinfacht bewerten zu können

Lehrinhalte

  • Gebäudetypologien (Niedrigenergie-, Passivhaus, Plusenergiegebäude)
  • Komfort und NutzerInnenakzeptanz
  • Energetische Sanierungskonzepte
  • Energieversorgungskonzepte für Gebäudekomplexe und Quartiere
  • Vereinfachte Nachhaltigkeitsbewertung von Gebäuden und Quartieren

Vorkenntnisse

Typische Kennzahlen aus der Stadtplanung (GFZ etc.) Konzept Energiedienstleistung, Energiebedarf, Energiedeckung, Primärenergiedeckung

Literatur

  • Daniels, Klaus (2001): Gebäudetechnik – Ein Leitfaden für Architekten und Ingenieure; Oldenbourg
  • Wosnitza, F. / Hilgers, H. G. (2012):Energieeffizienz und Energiemanagement, Springer
  • IBO – Institut für Bauen und Ökologie Hrsg (2016): Passivbauteilkatalog Sanierung; Birkhäuser (Energieeffizienz in der Bestandssanierung)
  • BMVIT 2015: Wärmenetz der Zukunft; Eigenverlag (gebäudeübergreifender Wärmeaustausch)
  • Schneider, U. / Zelger, T. / Böck, M. / Holweck, A. (2013): Plusenergiestandard für das Gründerzeithaus Cafe Weidinger, Lerchenfelder Gürtel; Haus der Zukunft
  • Zach, F. (2016): Innovative Konzepte zur Versorgung großvolumiger städtischer Gebäude/Quartiere mit PV und Geothermie, Stadt der Zukunft
  • Laasch T., Laasch E.: Haustechnik Grundlagen – Planung – Ausführung, 13 Auflage, Springer Verlag, 2013
  • Haus der Zukunft: https://nachhaltigwirtschaften.at/de/hdz/
  • Stadt der Zukunft: https://nachhaltigwirtschaften.at/de/sdz/
  • Forschung für die energieeffiziente Stadt: http://www.eneff-stadt.info/de/
  • http://www.e-genius.at/
  • http://www.audioakademie.at/

Leistungsbeurteilung

  • Präsentation
  • Projektarbeit
  • Mitarbeit
Modul 22 IKT (AMOD)
German / kMod
6.00
-
Datenanalyse (DATA)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Datenanalyse als Grundlage zur Unternehmenssteuerung.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Informationen im Unternehmen geeignet zu erfassen und entsprechend zu klassifizieren
  • Statistische Auswertungen durchzuführen und die Ergebnisse korrekt zu interpretieren
  • Datenanalyse als wesentlichen Input für die Entwicklung von technischen Konzepten zu verwenden
  • die Datenauswertung im Softwarelebenszyklus zu implementieren
  • die Grundlagen eines Data-Warehouse-Systems zu erklären

Lehrinhalte

  • Software life cycle
  • Dokumentation, Klassifikation von Information
  • Informationserfassung
  • Datenanalyse, Statistik
  • Einführung Data Warehousing
  • Data Warehouse Architektur
  • Data Warehouse Design
  • ETL Prozess

Vorkenntnisse

Kenntnisse und Erfahrung im Bereich Softwaretechnik bzw. Kenntnisse in SQL und RDBMS

Literatur

  • Studienbriefe
  • M. Nusselein (2003): Inhaltliche Gestaltung eines Data Warehouse-Systems am Beispiel einer Hochschule, Bayerisches Staatsinstitut für Hochschulforschung und Hochschulplanung
  • M. Oestreich, O. Romberg (2009): Keine Panik vor Statistik! - Erfolg und Spaß im Horrorfach nichttechnischer Studiengänge, Vieweg+Teubner | GWV Fachverlage GmbH, Wiesbaden (Bezug: SpringerLink)
  • J. Bortz (2004): Statistik, Springer Medizinverlag Heidelberg, 6. Auflage

Leistungsbeurteilung

  • Übungen
  • Test
Smart Data (SMD)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

In der Lehrveranstaltung lernen die Studierenden Grundlagen der verteilten urbanen Datenquellen, Smart Cities Lösungen unter Einbindung unterschiedlicher Datenquellen, die Funktionsweise von Verschlüsselung und Signatur von Informationen sowie deren Anwendung.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Das Konzept der Signaturen und Verschlüsselung erklären
  • Smart City Lösungen unter Einbindung unterschiedliche Datenquellen konzipieren
  • Informationen geeignet zu erfassen und entsprechend zu klassifizieren

Lehrinhalte

  • Security Und Privacy
  • Digitale Signaturen
  • Verschlüsselung
  • Verteilte urbane Datenquellen im Bereich Verkehr und Energie (Sensoren, Aktuatoren, Electronic Tolling, DSRC, Smart Grids, Smart Buildings etc.)
  • Internet of Things (IOT) System-Architektur
  • Open Data
  • Datennutzung

Literatur

  • Eckert, C. (2006): IT-Sicherheit. Konzepte - Verfahren – Protokolle, Oldenbourg
  • Andelfinger, V.P. / Hänisch, T. (2014); Internet der Dinge: Technik, Trends und Geschäftsmodelle, Springer Gabler
  • Kopetz, Hermann (2011): Internet of things: Real-time systems. Springer
  • Weber, R. H. / Weber, R. (2010): Internet of Things. Springer

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung und Abschlussprüfung
Modul 23 Wahlmodul 2 (WMOD2)
German / kMod
6.00
-
Modul 23a AK2 - Urbane Logistik (AK23a)
German / kMod
6.00
-
Technische Logistik und Flottenmanagement (AK2TLOG)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Der Kurs "Technische Logistik und Flottenmanagement" gibt einen Kurzüberblick über die wichtigsten Transportlogistik-Abläufe und dem Nutzerpotential von Informations- und Kommunikations-Technologien (IKT) und Intelligenten Verkehrssystemen (IVS).

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Die wichtigsten Grundbegriffe im Umfeld der Transportlogistik im internationalen Praxisumfeld entsprechend einzusetzen
  • basierend auf vorhanden technologischen Anwendungen in der Transportentwicklung diese weiterzuentwickeln, d.h. insb. Anforderungsanalysen zu erarbeiten und technische Umsetzungskonzepte zu konstruieren
  • Verkehrsinformationen und –anwendungen für konkrete Transportlogistik-Prozesse abzuleiten und potentielle Integrationsmöglichkeiten dieser in technologische Anwendungen zu planen

Lehrinhalte

  • Logistik und Logistikmanagement (Grundbegriffe und Definitionen)
  • IT in der Logistik (RFID, eFreight)
  • Transportplanung (Verkehrsinformationen, Software-Anwendungen)
  • Transportdurchführung (Sendungsverfolgung, rechtliche Aspekte)
  • Transportsicherheit (inkl. Technologien)
  • Flottenmanagement (Sensoren, digitaler Tachograph)

Vorkenntnisse

Verkehrssysteme, IKT, Management.

Literatur

  • Klatt, Gerhard (2017): Technische Logistik und Flottenmanagement, Wien, (Skript)

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung (Kursarbeit) und Abschlussprüfung

Anmerkungen

Gast-Vorträge während Kurs.

Urbane Logistik (AK2ULOG)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Im Zuge dieser Lehrveranstaltung wird das Thema der urbanen Logistik näher beleuchtet. Hierbei liegt der Fokus auf dem "Was?", "Warum?", "Wie?": "Was wird transportiert?", "Warum wird es transportiert?", und "Wie wird es transportiert?" Anhand von (teilweise internationalen) Beispielen wird die Thematik genauer beleuchtet, sodass letztlich die Teilnehmer und Teilnehmerinnen dieser Lehrveranstaltung selbst befähigt sind, urbane Logistikaufgabenstellungen mit zukunftsweisenden Methoden zu lösen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Aufgabenstellungen der urbanen Logistik zu erkennen
  • Aufgabenstellungen der urbanen Logistik zu lösen
  • Lösungemethoden in der urbanen Logistik zu bewerten

Lehrinhalte

  • Logistik-Trends und spezieller Handlungsbedarf in Städten
  • Entwicklungen und Herausforderungen
  • Akteure und deren Erwartungen
  • Klassische Ansätze zur Sammlung und Verteilung von Waren in Städten (Verkehrsträger, Verkehrsmittel, Ladungsträger, Touren- und Routenplanung, etc)
  • Innovative Ansätze zur Bündelung, Optimierung und Ressourcenschonung
  • City-Logistics-Projekte (Case Studies)

Vorkenntnisse

keine speziellen - Lehrinhalte der LV "Technische Logistik und Flottenmanagement"

Literatur

  • Gonzalez-Feliu / Semet / Routhier (2014): Sustainable Urban Logistics: Concepts, Methods and Information Systems, Springer
  • Schrampf, J. / Zvokelj, A. / Hartmann, G.(2013): Smart Urban Logistics. Effizienter Güterverkehr in Ballungszentren Strategisches Gesamtkonzept http://www.smartcities.at/assets/01-Foerderungen/SmartUrbanLogistics-Gesamtkonzept-v1-0-Web.pdf

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung (Kursarbeit) und Abschlussarbeit (in Heimarbeit)
Modul 23b AK2 - Elektromobilität (AK23b)
German / iMod
6.00
-
Aktuelle Themen der Elektromobilität (AK2ELMOB)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Basierend auf einer Einführung in die Elektromobilität (Gesetzgebung, Fahrzeuge, Energiebedarf, Energiespeicher, Ladetechnik, Business Modelle) werden die aktuellen Trends und Entwicklungen in Form von Case Studies von den Studierenden erarbeitet/bewertet und diskutiert. Ebenso werden bestehende und mögliche Business Modelle für verschiedenen Bereiche der Elektromobilität (Car-sharing etc.) vorgestellt.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Aktuelle Trends der Elektromobilität, hinsichtlich der technischen und wirtschaftlichen Faktoren zu bewerten
  • Technische und nicht technische Faktoren für den erfolgreichen Einsatz von Elektromobilität zu benennen
  • Business Modelle für Elektromobilität zu bewerten
  • Erfolgsfaktoren anhand internationaler Elektromobilitätsbeispielen (Case Studies) aufzuzählen
  • Derzeitige Gesetzgebung für Elektromobilität zu beurteilen
  • Trends bei Energiespeichern (Kosten, Technologie, Akteure) zu spezifizieren
  • Existierende State-of-The-Art Ladetechniken zu evaluieren
  • Existierende Fahrzeugtypen je nach Elektrifizierungsgrad systematisch zu beschreiben

Lehrinhalte

  • Entwicklungen und Herausforderungen bei der Einführung von Elektromobilität (Gesetzgebung, Fahrzeuge, Reichweite, Ladeinfrastruktur, Energiespeicher)
  • Urbane Anwendungsfälle der Elektromobilität
  • Akteure und deren Erwartungen
  • Businessmodelle der Elektromobilität
  • Case Studies der Elektromobilität

Literatur

  • Cocca, S. / Fabry, C. / Styrja, C. (2015): Dienstleistungen für Elektromobilität, Fraunhofer
  • Karle, A. (2015): Elektromobilität: Grundlagen und Praxis, Hanser
  • Wallentowitz, Henning / Freialdenhoven, Arndt (2011): Strategien zur Elektrifizierung des Antriebsstranges, Springer
  • Proceedings aktueller Konferenzen (etwa: e-motion, urban-city, …)

Leistungsbeurteilung

  • Case Studies und Abschlussprüfung
Modul 23c AK2 - Sensorik und Regelungstechnik (AK23c)
German / kMod
6.00
-
Regelungstechnik (AK2REG)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Es werden die Grundlagen der Regelungstechnik vermittelt und im Zuge einer Laboreinheit auch praktisch angewandt

Methodik

Vorlesung und Labor

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Nach erfolgreichen Abschluss der LV sind die Studierenden in der Lage:• Ein einfaches Regelungstechniksystem im Labor zu identifizieren, zu regeln und zu optimieren
  • Nach erfolgreichen Abschluss der LV sind die Studierenden in der Lage:
  • Ein einfaches Regelungstechniksystem im Labor zu identifizieren, zu regeln und zu optimieren

Lehrinhalte

  • Grundlagen RegelungstechnikStrecken, Regler, Stabilität, Fuzzy Logik, Genetische Algorithmen

Vorkenntnisse

keine

Literatur

  • Einführung Regelungstechnik, Busch

Leistungsbeurteilung

  • Schriftliche Prüfung und Laborbericht
Sensorik (AK2SEN)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Kurze Einführung in die Grundprinzipien der Sensorik - Prinzip des Transducers und dessen CharakteristikMessfehler und lineare RegressionDiskussion physikalischer Signale, deren deterministischer und statistischer CharakterPrinzip der Signalausbreitung auf LeitungenAnwendung elektronischer Bauelemente als sensorisches Element zur Erfassung physikalischer Größen und Darstellung derer als elektrische Größe

Methodik

Klassische Vorlesung mit Beispielen und Übungen zur Illustration des Funktionsprinzips und Vertiefung des Stoffgebiets.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Verständnis für das Wesen der Sensorik, die verwendeten Methoden und Prinzipien der Umwandlung einer physikalischen Größe in ihre elektrische RepräsentationVerständnis des Signalbegriffes und der Behandlung des deterministischen als auch statistischen Wesens von physikalischen SignalenBerechnung von Signalkennwerten. Verwendung idealer/nicht idealer elektronischer Bauelemente als sensorischer WandlerPrinzipien und Möglichkeiten der Erfassung physikalischer GrößenPhysikalische Wandlerprinzipien und deren Anwendung in der Sensorik mit verkehrstelematischem Schwerpunkt

Lehrinhalte

  • Kurze Einführung in das Gebiet und Wesen der SensorikVorstellung der SI Einheiten als Basisbezugssystem für MessungenCharakterisierung von Sensoren als mehrfache Wandler und deren KennlinieMethoden der linearen Approximation des Kennlinienverlauf und lineare Regression. Charakterisierung von stochastischen und deterministischen SignaleWahrscheinlichkeitsdichtefunktion und Spektrum verschiedener RauschartenBerechnung von SignalkennwertenPrinzip der Wellenausbreitung auf Übertragungsleitungen, Telegraphengleichung, Reflexion und WellenwiderstandPhysikalische Grundlagen der Stromleitung in FestkörpernElektrische Widerstände und deren Anwendungen als sensorisches ElementThermisch veränderliche Widerstände, Thermistoren, magnetoresisitive SensorenPiezoresistive SensorenElektrisches Feld, Begriff des elektrischen Potentials, kapazitive Bauelemente und deren Anwendung als SensorFeuchtemessung und Grundlagen der MEMSBeschleunigungssensoren, Gyroskope und TrägheitsnavigationssystemeMagnetisches Feld und induktive Sensoren, Grundlagen der Akustik und akustische Sensoren

Vorkenntnisse

Keine fachspezifischen Voraussetzungen notwendigElektronische und physikalische Vorkenntnisse auf BSc. Niveau aber von Vorteil

Literatur

  • Jacob Fraden, Handbook of modern sensorsIan Sinclair, Sensors and TransducersIan Sinclair, Passive componentsOwen Bishop, electronics - Circuits and systems

Leistungsbeurteilung

  • Schriftliche Prüfung und Projekt am Ende des Semesters.
Modul 23d AK2 - Verteilte und Zuverlässige Systeme (AK23d)
German / iMod
6.00
-
Verteilte und Zuverlässige Systeme (AK2VSYS)
German / ILV, FL
6.00
4.00
Modul 23e AK2 - Urbane Beleuchtung (AK23e)
German / iMod
6.00
-
Lichttechnologien für urbane Beleuchtung (AK2LICHT)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

In dieser Vorlesung werde urbane Beleuchtungen behandelt.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung, Übungen im Labor

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Relevante physikalische Eigenschaften von Leuchtmitteln aufzählen und deren Bedeutung erläutern zu können.
  • technisch relevante Leuchtmittel, deren Vor- Nachteile und Anwendungsgebiete aufzählen zu können.
  • Verfahren zur Regelung und Ansteuerung von Leuchtmitteln aufzählen und erklären zu können.
  • Planungsgrundlagen zu Innenraum und Freiraum-Lichtsystemen aufzählen und anwenden zu können.
  • optische Parameter der Lichtplanung aufzählen zu können wie Raumwinkel, Lichtstrom, Lichtausbeute, Beleuchtungsstärke, Tageslichtquotient, Leuchtdichte, Farbtemperatur, optischer Wirkungsgrad
  • wahrnehmungspsychologische Aspekte von Beleuchtung zu erläutern und relevante Begrifflichkeiten, wie Akkommodation, Adaption Sehschwellen, Gesichtsfeldparameter, Wahrnehmungsmodelle, aufzuzählen sowie deren Bedeutung zu erklären.
  • relevante physikalische und wahrnehmungspsychologische Aspekte von Farbe zu erklären.

Lehrinhalte

  • Lichttechnische Grundlagen
  • Licht und Wahrnehmung
  • Überblick über Leuchtmittel
  • Ansteuerung und Regelung von Leuchtmitteln
  • Konzeption von Lichtsystemen (technisch und wirtschaftlich)
  • Innenraum-, Freiraumanlagen, Sicherheitsbeleuchtung, Notbeleuchtung

Literatur

  • Hering, E. / Martin, R. (2006): Photonik: Grundlagen, Technologie und Anwendung, Springer Verlag
  • Ris, H. R. (2015): Beleuchtungstechnik für Praktiker: Grundlagen, Lampen, Leuchten, Planung, Messung, VDE Verlag
  • Witting, W. (2014) Licht. Sehen. Gestalten. Lichttechnische und wahrnehmungs-psychologische Grundlagen, Birkhäuser Verlag
  • Versuchsanleitungen

Leistungsbeurteilung

  • Abschlussprüfung und Benotung der Laborprotokolle
Modul 23f AK2 - Bildverarbeitung (AK23f)
German / iMod
6.00
-
Anwendungsorientierte Bildverarbeitungstechnologien (AK2BILD)
German / ILV, FL
6.00
4.00
Modul 24 Projekt 2 (PRJ2)
German / iMod
6.00
-
Projektarbeit 2 (PRJ2)
German / PRJ
6.00
4.00

Kurzbeschreibung

Umsetzung des im 1. Semester analysierten Projekts

Methodik

Projektseminar

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • funktionale Anforderungen in eine detaillierte Umsetzungsplanung überführen
  • Zeit- und Ressourcen abzuschätzen und zu planen
  • Anforderungen gemäß Planung zu implementieren
  • Resultate in Form eines wissenschaftlichen Papers darzustellen

Lehrinhalte

  • Umsetzung von Projekten in (interdisziplinärer) Teamarbeit
  • Führen eines Projekthandbuchs
  • Detailspezifikation
  • Zeit und Ressourcenplanung
  • planungsgemäße Umsetzung eine Projektimplementierung

Vorkenntnisse

Projektarbeit 1, technische Vorkenntnisse je nach Projektthema

Literatur

  • Abhängig vom Projektthema

Leistungsbeurteilung

  • LV-Immanent, Projektergebnis, Documentation, Präsentationen, Paper
Modul 25 Unternehmenskooperation (UKO)
German / kMod
6.00
-
Internationale Smart City Dimensionen (ISCD)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung behandelt die Einbettung einer Stadt/Region in supranationale Angelegenheiten, wie insbesondere die Europäische Gesetzgebung, Empfehlungen und Rahmenbedingungen, die Aktivitäten und Handlungsspielraum der Europäischen Kommission im Angesicht der Subsidiarität, die Rolle von Dachverbänden wie UITP, Eurocities, Polis, Konvent der Bürgermeister und zuletzt den Einblick in wichtige EU-Projekte.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Einbettung lokaler Aktivitäten in supranationale Rahmenbedingungen zu beurteilen
  • Einflussfaktoren nationaler und internationaler Instanzen zu erkennen und zu beurteilen sowie Chancen für die lokale Entwicklung abzuleiten
  • die Rolle der Standardisierung einschätzen zu können
  • Aktivitäten der lokalen Politik zu bewerten

Lehrinhalte

  • Hierarchische Gliederung Region - Staat – supranationale Organisationen
  • Europäische Gesetzgebung, Empfehlungen und Rahmenbedingungen
  • Aktivitäten und Handlungsspielraum der Europäischen Kommission im Angesicht der Subsidiarität
  • Rolle von Dachverbänden UITP, Eurocities, Polis, Konvent der Bürgermeister
  • Wichtige EU-Projekte: Aktivitäten und Erkenntnisse
  • Rahmenbedingungen außerhalb Europas

Vorkenntnisse

Absolvierte LVA "Stadtprozesse" (SPZ) empfohlen

Literatur

  • CEN TC278 WG3 (ITS Public transport) & review of some research projects paving the way
  • CEN TC278 Approach for Gap Analysis Urban ITS
  • Europäische Kommission (2013):: IVS-Expertengruppe für Urbane Bereiche, „Guidlines for ITS deployment in Urban Areas“
  • Europäische Kommission (2013): „Best Practices in Urban ITS -Collection of Projects”
  • Europäische Kommission (2013): Together towards competitive and resource-efficient urban mobility, COM 913 final
  • Europäische Kommission (2013): Mobilising Intelligent Transport Systems for EU cities, SWD(2013) 527 final
  • Europäische Kommission (2011): Weissbuch - Fahrplan zu einem einheitlichen europäischen Verkehrsraum – Hin zu einem wettbewerbsorientierten und ressourcenschonenden Verkehrssystem: KOM(2011) 144 endgültig
  • Europäische Kommission (2009): Aktionsplan urbane Mobilität: KOM(2009) 490
  • ISIS, CIVITAS in Europe, A proven framework for progress in urban mobility, 2007
  • KU Leuven, UITP, Study on Harmonised Collection of European Data and Statistics in the Field of Urban TraCnsport and Mobility, 2013
  • UN-Habitat (2013): Promoting Non-Motorized Transport in Asian Cities: Policymakers’ Toolbox
  • UN-Habitat, Indicators of urban, poor communities and their accessibility

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung
Organisationsentwicklung und Change Management (OECM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

In dieser Lehrveranstaltung werden die drei Schwerpunkte Reallaboratorien, Transformative Wissenschaft und Methoden der Transdisziplinarität behandelt. Mittels Rollensimulationen werden Beratungsgespräche mit unterschiedlichen städtischen Stakeholdern mittels Lektorentandem geübt. Erstellt wird eine schriftliche Konzeption für ein Reallabor.

Methodik

Inhaltliche Vermittlung und Lehrgespräch Exkursion Beratungssimulationen Poster Präsentationen Abschlussarbeit Fernlehrunterstützung per Moodle

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Anforderungen von Reallaboratorien zu benennen und diese exemplarisch in ein Konzept für ein Reallabor umzusetzen;
  • die Gütekriterien der auf Veränderung abzielenden Transformativen Wissenschaft plausibel darzulegen;
  • Methoden der Transdisziplinarität exemplarisch im Konzept für ein Reallabor vorzusehen und anderen InteressentInnen nachvollziehbar erklären zu können;
  • Beratungsgespräche mit unterschiedlichen urbanen Stakeholdern mittels systemischer Fragetypen wissensgenerierend führen zu können.

Lehrinhalte

  • Modelle urbaner Reallaboratorien
  • Transformative Wissenschaft als Begleitung transdisziplinärer Veränderungsprozesse
  • Systemische Fragetypen im Beratungsgespräch mit urbanen Stakeholdern
  • Konzeption eines Reallabors unter Einbindung transdisziplinärer Methoden

Vorkenntnisse

Anforderungen an Smart-City Konzepte

Literatur

  • Bergmann, M., Jahn, T., Knobloch, T., Krohn, W., Pohl, C., and Schramm, E., Methoden transdisziplinärer Forschung: Ein Überblick mit Anwendungsbeispielen, 1st ed. Campus Verlag, 2010. (Auszüge)
  • Rückert-John, J., ed., Soziale Innovation und Nachhaltigkeit. Innovation und Gesellschaft. Wiesbaden: Springer Fachmedien Wiesbaden, 2013. (Auszüge)
  • Schneidewind, U., ed., Transformative Wissenschaft: Klimawandel im deutschen Wissenschafts- und Hochschulsystem, 2nd ed. Metropolis, 2014. (Auszüge)
  • Schneidewind, U., Bürgeruniversität spiegelt den Dialogwunsch: Konzept der "Bürgerhochschule"; ein Katalysator für eine starke Bürgerwissenschaft. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2015. (moodle)
  • Uwe Schneidewind, Carsten v. Wissel, “Transformative Wissenschaft,” (accessed March 14, 2017). (moodle)
  • Schneidewind, U., Urbane Reallabore: Ein Blick in die aktuelle Forschungswerkstatt. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2014. (moodle)
  • Schneidewind, U. and Singer-Brodowski, M., Transformative Forschung als Motor für die Gestaltung von Systemübergängen: Auf dem Weg zu einem neuen Innovationsverständnis. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2013. (moodle)
  • Schneidewind, U., Pfriem, R., Barth, J., Beschorner, T., Binswanger, M., Diefenbacher, H., Eisenack, K. et al., Transformative Wirtschaftswissenschaft im Kontext nachhaltiger Entwicklung: Für einen neuen Vertrag zwischen Wirtschaftswissenschaft und Gesellschaft. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2016. (moodle)
  • Schneidewind, U., Transformative Wissenschaft: Motor für gute Wissenschaft und lebendige Demokratie. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2015. (moodle)
  • Schneidewind, U. and Singer-Brodowski, M., Vom experimentellen Lernen zum transformativen Experimentieren: Reallabore als Katalysator für eine lernende Gesellschaft auf dem Weg zu einer Nachhaltigen Entwicklung. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2015. (moodle)

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung

3. Semester

Bezeichnung ECTS
SWS
Modul 31 Stadtplanung (SPL)
German / kMod
6.00
-
Integrative Stadtplanung (ISPL)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Das Modul beschäftigt sich mit Theorie und Praxis kooperativer und integrativer Stadtplanung. Anhand von Casestudies aus der Praxis werden die Themenfelder, Akteure, Methoden und lessons learnt der nachhaltigen Quartiersentwicklung vermittelt.

Methodik

Gesprächsunterricht, Vortrag Einzel-/Gruppenarbeiten

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Handlungsfelder, Akteure und Instrumente integrativer Stadtplanung zu erklären
  • Beteiligungsmethoden und -formate für kooperative Planung anzuwenden
  • ganzheitliche Ansätze und Konzepte für nachhaltige Stadtquartiere zu entwickeln

Lehrinhalte

  • Wahrnehmung von Stadtregionen / Begrifflichkeiten (städtische Agglomeration, Stadt, Stadtteil, Quartier, Nachbarschaft)
  • Ziele und Akteure der Stadtplanung (Interessen, Ressourcen / Stakeholder-/Umfeldanalyse)
  • hoheitliche vs. informelle Stadtplanungsinstrumente
  • integrative und kooperative Stadtplanung / nachhaltige Quartiersentwicklung
  • Beteiligung, Beteiligungsmethoden (Stadtteilmanagement, Design Thinking, Urban living labs, ...)
  • nationale/interantionale Förderprogramme im Bereich Smart Cities/kooperative, nachhaltige Stadtentwicklung

Vorkenntnisse

Modul 15

Literatur

  • Bott, H. / Grassl, G. / Anders, S..(2013): Nachhaltige Stadtplanung: Konzepte für nachhaltige Quartiere, Edition Detail
  • Gehl, J. (2015): Städte für Menschen, Jovis
  • Mieg, H. / Heyl, Ch. (2013): Stadt. Ein interdisziplinäres Handbuch, J.B. Metzler Verlag
  • Netsch, S. (2015): Stadtplanung. Handbuch und Entwurfshilfe, DOM publishers
  • Ring, K. (2015): Urban Living: Strategien für das zukünftige Wohnen, Jovis
  • Witzany, G. (2010): Zukunftsfähige Stadt- und Verkehrsplanung. Wieviel Kohr braucht die City? BoD, Norderstedt

Leistungsbeurteilung

  • lehrveranstaltungsimmanente Beurteiliung, schriftliche Reflexion
Kritische Infrastrukturen (KINF)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Kritische Infrastrukturen: Kennenlernen der historischen Entwicklung bis zur aktuellen Situation.

Methodik

Interaktiver Vortrag mit audiovisuellen Komponenten.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • kritische Infrastrukturen im urbanen Bereich zu identifizieren
  • einen Business Continuity Plan & Disaster Recovery Plan anhand eines praktischen Fallbeispiels im Rahmen von geführten Kleinprojekten durchzuführen.
  • die grundsätzlichen Prinzipien der Informationssicherheit und des Datenschutzes zu benennen

Lehrinhalte

  • Bedeutungen kritischer Infrastrukturen
  • Informationsinfrastrukturen
  • Schutz kritischer Infrastrukturen
  • Business Continuity und Desaster recovery

Vorkenntnisse

Verständnis der Domänen IT, Energie und Mobilität im urbanen Kontext

Literatur

  • Ebert Christof (2013): Risikomanagement kompakt- Risiken und Unsicherheiten bewerten und beherrschen, 2. Auflage, Springer Vieweg, 978-3-642-41048-2
  • Königs, Hans-Peter (2013): IT-Risikomanagement mit System - Praxisorientiertes Management von Informations-sicherheits- und IT-Risiken, 4. Auflage, Springer, ISBN 978-3-8348-2165-2
  • Wiater, Patricia (2013): Sicherheit durch den 'Schutz kritischer Infrastrukturen', Nomos

Leistungsbeurteilung

  • Abschlussprüfung
Modul 32 Simulation (SIM)
German / kMod
6.00
-
GIS (GIS)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Der Kurs vermittelt den Studierenden einen weiteren Blick auf geographische Informationssysteme. Zu Beginn werden Grundlagen wie Koordinatensysteme und die Unterschiede zwischen Raster- und Vektor-Daten behandelt. Speichermechanismen, wichtige Algorithmen und deren Anwendung werden gezeigt. Im weiteren Verlauf werden werden komplexere Probleme wie beispielsweise Datenqualität diskutiert. Den Abschluss bilden eine rechtliche und wirtschaftliche Betrachtung geographischer Informationen.

Methodik

Frontalvorlesung mit 2 begleitenden Hausaufgaben und einem selbstgewählten Projekt anhand dem die in der Vorlesung angesprochenen Punkte durchgedacht werden sollen.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Probleme, die beim Entwurf eines Geoinformationsproduktes auftreten, zu benennen
  • Daten und notwendige Qualität zu beschreiben
  • ein Geoinformationsprodukt zu designen und zu präsentieren

Lehrinhalte

  • Koordinatensysteme und -Rahmen (lokal und global)
  • Arten von GIS: Raster- und Vektor-GIS
  • Darstellung von Raster- und Vektor-Daten im Computer
  • GIS-Operationen für Raster- und Vektor-Datensätze
  • Datenqualität
  • Entwurf von Geoinformationsprodukten: Kosten-Nutzen-Analyse
  • Rechtliche Rahmenbedingungen von Geodaten
  • Typische Datensätze und woher man sie bekommt

Vorkenntnisse

Grundlagen der Mathematik, Kreativität

Literatur

  • Cho, G., Geographic Information Science: Mastering the Legal Issues. 2005: John Wiley & Sons, Ltd.
  • Tomlinson, R. Thinking about GIS. 2007: ESRI Press
  • Worboys, M.F., GIS: A Computing Perspective. 1995, London: Taylor & Francis

Leistungsbeurteilung

  • Mündliche Prüfung
  • Hausaufgaben (am Computer)
  • Präsentation des Projektes samt schriftlicher Ausarbeitung
Simulation (SIM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Diese Vorlesung befasst sich mit der Simulation von Verkehrssituationen in der Stadt. Daraus werden Kenntnisse über verschiedene Ansätze zur Stadtmodellierung vermittelt. Geodatenviewer der Stadtvermessung Wien werden dafür verwendet. Die Grundlagen für die Generierung von Verkehr werden ebenso erklärt.

Methodik

Vorlesung Diskussionen Gruppenarbeiten Präsentationen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Städte unter Berücksichtigung von Geodatenviewer der Stadtvermessung Wien zu modellieren
  • Verkehr in der generierten Szenarien zu simulieren
  • Methoden zur Datenerfassung und Speicherung in Datenbanken zu entwerfen

Lehrinhalte

  • Geodatenviewer der Stadtvermessung Wien
  • CityEngine
  • Konverter für Datenumformatierung
  • Unity 3D fuer die Erstellung von Strassen und Verkehr
  • Esrtellung SQLite Datenbank

Vorkenntnisse

Keine

Literatur

  • Unity 3D Tutorials https://unity3d.com/de/learn/tutorials
  • Introduction to the CityEngine tutorials http://desktop.arcgis.com/en/cityengine/latest/tutorials/introduction-to-the-cityengine-tutorials.htm
  • Handbook of Research on Social, Economic, and Environmental Sustainability ...herausgegeben von Vesco, Andrea
  • Unity 3D UI Essentials, Simon Jackson

Leistungsbeurteilung

  • Präsentationen, Project, Gruppenarbeit
Modul 33 Wahlmodul 3 (WMOD3)
German / kMod
6.00
-
Modul 33a AK3 - IT Sicherheit in Energie und Mobilität (AK33a)
German / iMod
6.00
-
IT Sicherheit in Energie und Mobilität (AK3ITSEC)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung beschäftigt sich mit IT-Sicherheit in den Bereichen der Mobilität und der Energie

Methodik

Vorlesungen, Übungen, gemeinsames interdisziplinäres Projekt

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Mechanismen, Konzepte und Modelle der Zugriffskontrolle hinsichtlich Identifikation, Authentifikation sowie Rechteverwaltung (auch in verteilten Umgebungen) zu erläutern und zu bewerten.
  • Anforderungen sicherer Kommunikation (Netze, Dienste, verteilte Anwendungen) zu erläutern und die hierfür benötigten Verfahren resp. Protokolle zu beschreiben.
  • Gängige Verwundbarkeiten und Bedrohungen anhand aktueller Sicherheitsvorfälle zu kategorisieren.
  • Risiken von kritischer Infrastruktur (Stromversorgung, Verkehrsinfrastruktur) zu nennen
  • Auswirkungen von Ausfällen kritischer Infrastruktur wie etwa von Blackouts, nennen und beschreiben zu können
  • Lösungsansätze um kritische Verkehrs- und Energieinfrastrukturen sicher und resilient gegen Angriffe und Naturkatastrophen abzusichern, zu beschreiben

Lehrinhalte

  • IT Security Sicherheitskonzepte und –modelle anhand ausgewählter Beispiele
  • Authentizität
  • Identifizierungs- bzw. Authentifizierungsmodalitäten
  • Trusted Computing
  • Redundanzen
  • IT Sicherheit von Kritischer Infrastruktur (Stromversorgung, Smart Meter, Verkehrsinfrastruktur, Internetinfrastruktur)
  • Resiliente IT Infrastrukturen
  • Wechselwirkungen / Dominoeffekte von abhängigen IT Infrastrukturen

Literatur

  • Eckert, C. (2006): IT-Sicherheit. Konzepte - Verfahren – Protokolle, Oldenbourg
  • Geminn, Ch.L. (2014): Rechtsverträglicher Einsatz von Sicherheitsmaßnahmen im öffentlichen Verkehr
  • Saurugg, H. (2011): Smart Metering und mögliche Auswirkungen auf die nationale Sicherheit, Cyber Security Austria
Modul 33b AK3 - Smart Healthcare (AK33b)
German / kMod
6.00
-
Crowd Sourced Healthcare in Smart Cities (AK3HEALTH)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstalung beschäftigt sich mit technischen Systemen, Prozessen und Standards zur crowd basierten Datenaufnahme, Transfer und Integration in Gesundheitsakten. Ebenso wird Einsicht in aktuelle und zukünftige interoperables Dokumentenformate zur Datenspeicherung gegeben.

Methodik

Vorträge, Diskussionen und Gruppenarbeiten zu den verschiedenen Themen, selbstständiges Erarbeiten von zur Verfügung gestellten Themenbereichen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • aktuelle Konzepte zur crowd basierten Datenaufnahme im med. Kontext wiederzugeben
  • standards und Prozesse zur Systemintegration von personalisierten med. Daten zu erklären und zu beschreiben
  • technische grundlagen interoperabler medizinischer Dokumente zu beschreiben und wiederzugeben

Lehrinhalte

  • Crowed Sourced Health Intro, X73 Standard
  • Medical Device Connectivity from international standards perspective
  • FHIR – Fast Healthcare Interoperability Resources
  • CDA - Clinical Document Architecture

Vorkenntnisse

- Einfache Programmierkenntnisse - Grundlegend technisches Verständnis und Interesse - Erste Kenntnisse des Medizinwesens von Vorteil

Literatur

  • Unterlagen im CIS
  • http://www.continuaalliance.org/
  • https://www.hl7.org/fhir/
  • Moodle Links

Leistungsbeurteilung

  • Praktische Übungen und Aufgaben
Integration und Nutzung vernetzter medizinischer IT Infrastrukturen (AK3MED)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die LVA legt ein besonderes Augenmerk auf die IHE Technical Frameworks (Verwendung in ELGA) zum standardisierten, interoperablen und zukunftssicheren Austausch von Daten mittels medizinischen Informationssystemen auf nationaler und internationaler Ebene.

Methodik

Vorträge, Diskussionen und Gruppenarbeiten zu den verschiedenen Themen, selbstständiges Erarbeiten von zur Verfügung gestellten Themenbereichen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Basis Terminologien von IHE zu verwenden
  • den IHE Connectathon und die Abläufe zu erklären und die Anforderungen zu beschreiben
  • die Unterschiede zwischen den Profilen XDR, XDM und XDS sowie deren Querverbindungen zu beschreiben
  • die IHE Cross-Community Profile XCA und XCPD zu beschreiben
  • das Identity Management (basierend auf PIX, PDQ) in IHE zu beschreiben
  • die Grundlagen der IT-Security basierend auf IHE Security Profilen (CT, ATNA, XUA, BPPC) zu erklären
  • die ELGA Architektur und Sicherheitsanforderungen von ELGA zu beschreiben

Lehrinhalte

  • Terminologien der IT-Standardisierung
  • Grundverständnis von IHE und Interoperabilität
  • Document Exchange Profile anhand der elektronischen Gesundheitsakte ELGA
  • IT-Security Profile am Beispiel der elektronischen Gesundheitsakte

Vorkenntnisse

- Einfache Programmierkenntnisse von Vorteil - Erste Kenntnisse des Medizinwesens von Vorteil

Literatur

  • Unterrichtsmaterialien im CIS
  • http://ihe.net/Technical_Frameworks/
  • http://elga.gv.at/
  • Moodle Links

Leistungsbeurteilung

  • Einzel und Gruppenübungen
Modul 33c AK3 - Big Data (AK33c)
German / kMod
6.00
-
Semantische Wissensrepräsentation und Linked Data (AK3SEM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Vor mittlerweile mehr als zwei Jahrzehnten wurde das World Wide Web erfunden. War es anfangs nur dazu gedacht, Dokumente über unterschiedliche Systeme hinweg zu vernetzen, wurde es rasch zum größten und erfolgreichsten jemals von Menschen geschaffenen Wissensrepräsentationssystem. Heute beeinflusst das Web unsere soziale Interaktion, unsere kulturelle Entwicklung und treibt maßgeblich den digitalen Wandel in unterschiedlichen Wirtschaftssektoren und Industrien. Eine globale, Netzwerk-zentrische Perspektive kombiniert mit dezentralen Informationssystemarchitekturen und offenen Standards sind die fundamentalen Design-Prinzipien auf denen der Erfolg des Webs beruht. In den letzten Jahren, wurden diese Prinzipien auch in anderen Kontexten, wie zum Beispiel Linked Data, angewendet um global vernetzte Datennetzwerke aufzubauen. Auch virtuelle Währungssysteme, wie Bitcoin, beruhen auf diesen Prinzipien und ermöglichen mittlerweile globale Transaktionen ohne Intermediäre oder zentrale Stellen. Das Ziel dieses Kurses besteht darin, Design-Prinzipien und Technologien zu vermitteln die zum Aufbau global vernetzter Informations-, Daten-, und Finanz-Transaktionsnetzwerke verwendet werden. Außerdem soll deren praktische Anwendungen demonstriert und soziale bzw. gesellschaftliche Implikationen diskutiert werden.

Methodik

Dieser Kurs umfasst Vorlesungen, Literatur-Recherche und die Ausarbeitung von wöchentlichen Hausaufgaben.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Design-Prinzipien und technischen Architekturen global vernetzter Systeme (Web, Linked Data) zu erklären
  • Websites mit strukturierten Daten zu versehen um dieses für Suchmaschinen zu optimieren
  • die Prinzipien offener Standards zu verstehen und zu deren Entwicklung beizutragen
  • virtuelle Währungssysteme (z.B.: Bitcoin) sowie die darunter liegende Blockchain-Technologie aus technischer Perspektive zu erklären

Lehrinhalte

  • Global Information Networks | Architecture of the World Wide Web
  • Global Data Networks | Linked Data Technologies
  • Global Data Networks | Publishing and making use of Structured Web Data (schema.org, OpenGraph)
  • Global Financial Networks | Bitcoin and Blockchain Technology

Vorkenntnisse

Basic understanding of Web markup languages (e.g. HTML) Basic understanding of distributed networks and protocols (e.g., TCP/IP)

Literatur

  • V. Bush. As We May Think; Atlantic Monthly; July 1945.
  • I. Jacobs, N. Walsh, Architecture of the World Wide Web, W3C 2004
  • T. Heath, C. Bizer Linked Data: Evolving the Web into a Global Data Space, Chapters 1-3
  • T. Berners-Lee et al. Creating a Science of the Web
  • Schema.org Tutorial: http://schema.org/docs/gs.html
  • Open Graph protocol: http://ogp.me/
  • Bitcoin: A Peer-to-peer Electronic Cash System
  • Ethereum White paper: https://github.com/ethereum/wiki/wiki/White-Paper

Leistungsbeurteilung

  • Wöchentliche Hausaufgaben
Technische Konzepte Big Data (AK3TBD)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Der Kurs behandelt die grundlegenden Elemente von technischen Konzepten im Big Data Bereich. Es werden die Anforderungen und die Herausforderungen an die Technologien anhand von Beispielen in Smarter Cities besprochen.

Methodik

Vorlesung mit interaktiver Beteiligung und integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Begriffe von Big Data, Data Mining und Information Retrieval sinngemäß zuzuordnen und damit verbundene Verfahren und Methoden anzuwenden
  • Technischen Grundlagen von Suchmaschinen & Analysemöglichkeiten zu beurteilen und einzuschätzen
  • Hadoop als Grundlage für einfache Big Data Anwendungen einzusetzen
  • Grundlegende Architekturen, Konzepte & Verarbeitungsschritte in einem Data Mining Prozess & Algorithmen zu beurteilen
  • Einfache Einarbeitung in Spezialthemen infolge des erlangten, thematischen Überblicks aus den Bereichen Big Data, Data Mining und Information Retrieval

Lehrinhalte

  • Einführung in die Themen Big Data, Information Retrieval und Data Mining
  • Basismodelle des Information Retrieval (Boolesches Modell, Vektorraummodell, Propabiistisches Modell)
  • State of the Art Big Data Tools: Hadoop, Apache Spark, Mahout, Cloudera, etc.
  • Grundlegende Konzepte der Machine Learning Algorithmen
  • Spezialthemen je nach Interesse der Studierenden aus den Bereichen Crawling, Indexierung, Ranking, Clustering, Classification, Big Data Analytics, Machine Learning, Verarbeitung unstrukturierter Daten, diverse Methoden des Minings und Retrievals, diverse Tools

Vorkenntnisse

Grundlagen von Big Data & Analyseverfahren, Grundlagen von Technologien & Entwicklungs/Analyseplattformen

Literatur

  • Baeza-Yates, R. / Ribeiro-Neto, B. (2011): Modern information retrieval: the concepts and technology behind search, Second edition. ed. Addison Wesley, New York.
  • Baron, P. (2013): Big Data für IT-Entscheider: riesige Datenmengen und moderne Technologien gewinnbringend nutzen. Hanser, München.
  • Berger, H., et al (2014); Conquering Data in Austria, BMVIT
  • Ferber, R. (2003): Information Retrieval: Suchmodelle und Data-Mining-Verfahren für Textsammlungen und das Web, 1. Aufl. ed. dpunkt-Verl, Heidelberg.
  • Köhler, M. et. al. (2014): #BigData in #Austria – Österreichische Potenziale und Best Practice für Big Data, BMVIT
  • Leskovec, J. / Rajaraman, A. / Ullman, J.D. (2014): Mining of massive datasets. Cambridge University Press.
  • Lewandowski, D. (2005): Web Information Retrieval: Technologien zur Informationssuche im Internet, Reihe Informationswissenschaft der DGI. Dt. Ges. für Informationswiss. und Informationspraxis, Frankfurt am Main.
  • Manning, C.D. /, Raghavan, P. / Schütze, H. (2008); Introduction to information retrieval. Cambridge University Press, New York.
  • Mayer-Schönberger, V. / Cukier, K. / Mallett, D. (2013). Big Data: die Revolution, die unser Leben verändern wird, 2. Aufl. ed. Redline-Verl, München.
  • Wartala, R. (2012): Hadoop: zuverlässige, verteilte und skalierbare Big-Data-Anwendungen, Professional reference. Open Source Press, München.

Leistungsbeurteilung

  • Schriftliche Abschlussprüfung, Mitarbeit, Ausarbeitung u Präsentation von: Fallstudien, Business Case und Prototyp
Modul 33d AK3 - Autonomes Fahren (AK33d)
German / iMod
6.00
-
Autonomes Fahren (AK3AUTF)
German / ILV, FL
6.00
4.00
Modul 33e AK3 - Kooperative Systeme (AK33e)
German / iMod
6.00
-
Kooperative und vernetzte Systeme (AK3KOPS)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Introduction into the field of vehicle-vehicle-interaction and infrastructure-vehicle interaction. The course is organized around core technologies like wireless communication or human machine interaction and reference projects.

Methodik

Lecture

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • The student is familiar with vehicle-infrastructure-interaction, it's applications and technologiesKnowledge about inter-relations of applicationsKnowledge about proven technologies and existing challenges

Lehrinhalte

  • Systems view of VIICommunication TechnologyHuman FactorsxFCDImportant projects (Coopers, etc.)Trends in Traffic ManagementRole of infrastructural data

Vorkenntnisse

ITS technologies (HMI, wireless communication technology).

Literatur

  • Conference proceedings on ITS world congressIEEE

Leistungsbeurteilung

  • Written examination
Modul 34 Spezialisierung (WMOD3)
German / kMod
6.00
-
Spezialisierung (SPEZ)
German / SE
3.00
2.00

Kurzbeschreibung

Wissenschaftliche Bearbeitung spezieller Fachbereiche in Bezug auf die individuellen Masterthesen in Kleingruppen. Formulierung wissenschaftlicher Fragestellungen sowie Literaturrecherche und Diskussion aktueller Forschungsergebnisse als mögliche Grundlage der eigenen Masterthesen.

Methodik

Vertiefende Bearbeitung von studiengangsrelevanten Fachgebieten in Kleingruppen.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • wissenschaftliche und praktische Grundlagen, Methoden, Technologien und Anwendungsgebiete im Fachgebiet der jeweiligen Masterthese schriftlich als Grundlage der jeweiligen Masterthese aufzubereiten.
  • unter Verwendung der Ergebnisse der LV Ihre Masterthese entsprechend den Vorgaben auf wissenschaftlich hohem Niveau umzusetzen

Lehrinhalte

  • Literaturrecherche und state of the art (Literaturliste)
  • Diskussion wissenschaftlicher Paper und Erarbeitung von Themensynergien
  • Erarbeitung wissenschaftlicher Fragestellungen und Methodiken
  • Erstellung Proposal Master Thesis
  • Quellen- und Wissenslandkarte

Vorkenntnisse

Fachliche Expertise der vorangehenden Semester, Wissenschaftliches Arbeiten

Literatur

  • abhängig von gewählten Themengebiet

Leistungsbeurteilung

  • LV immanent
Wissenschaftliches Arbeiten (WIA)
German / SE
3.00
2.00

Kurzbeschreibung

In dieser Lehrveranstaltung entwickeln die Studierenden ein Untersuchungsdesign mit Hilfe lösungsorientierter Erhebungsmethoden auf der Basis von Forschungsfragen.

Methodik

Input-Präsentation, Gruppenarbeit, Workshop-Phasen.

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • eine curriculumsrelevante Forschungsfrage mit Bezug auf den State-of-the-art zu begründen und messbar zu formulieren.
  • die Phasen einer wissenschaftlichen Untersuchung mit einer curriculumsbezogenen Vorgehensweise zu planen.
  • die Methoden je nach Forschungsfrage/ Problemfall lösungsorientiert auszuwählen.
  • Forschungsergebnisse in einen gesellschaftlichen Zusammenhang zu stellen.

Lehrinhalte

  • Entwicklung und Formulierung einer Forschungsfrage
  • Phasen einer wissenschaftlichen Untersuchung
  • Kriterien der Methodenwahl
  • Forschungsergebnisse im gesellschaftlichen Kontext

Vorkenntnisse

Die Studierenden können eine (vorgegebene) Themenstellung mit der persönlichen, beruflichen und inhaltlichen Motivation darstellen. Die Studierenden können curriculumsrelevante quantitative und qualitative Methoden unterscheiden und beschreiben. Die Studierenden können curriculumsrelevante formale, empirische und argumentative Methoden unter Nennung der jeweiligen Erkenntnisgrenzen erläutern.

Literatur

  • T. Skern, Writing scientific English: A workbook, 2nd ed. Wien: Facultas.WUV, 2011.
  • Diekmann, A. (2007): Empirische Sozialforschung. Grundlagen, Methoden, Anwendungen. Rowohlt
  • Flick, U. (2007): Triangulation - Eine Einführung. VS
  • Flick, U. (2007): Qualitative Sozialforschung: Eine Einführung. Rowohlt
  • Froschauer, U.; Lueger, M. (2009): Interpretative Sozialforschung: Der Prozess, facultas wuv UTB.
  • Froschauer, U.; Lueger, M. (2003): Das qualitative Interview. Zur Praxis interpretativer Analyse sozialer Systeme. WUV-UTB Verlag.
  • Schnell, R.; Hill, P.B.; Esser, E. (2008): Methoden der empirischen Sozialforschung. Oldenbourg

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung
Modul 35 Wirtschaft (WMOD3)
German / kMod
6.00
-
Ausschreibungen und Innovationsmanagement (INNO)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Nach dem erfolgreichen Absolvieren der LV sind die Studierenden in der Lage: Verständnis und Fertigkeiten für innovative Prozesse und mögliche Finanzierungsformen von risikobehafteten Projekten (F&E) zu schaffen, dazu zählen: .) Systematik Forschung- Entwicklung - Innovation .) Systematische Planung von Projektinhalten und Ressourcen von der Projektidee zum Projektantrag mit Schwerpunkt geförderter Projekte .) Abwicklung und Monitoring von laufenden Projekten Projektabschluss und Verwertungsphase .) Projektakquisition und Beauftragungen

Methodik

Theoretische Grundlagen werden in den Vorlesungen vorgetragen, praktische Anwendungen und Übungen im Moodle ergänzen die Inhalte und regen die Studierenden zu eigener (kreativer) Arbeit an. Dabei können Einzelarbeiten oder Gruppenarbeiten erfolgen, die je nach Aufgabenstellung die Studierenden in reale Rollen im Innovationsprozess versetzen. (zB Antragsteller, Evaluierung, Verwertung, Kunde, etc. ...)

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Prinzipien des Innovationsmanagement zu erklären
  • Ideen für Innovationen für Smart City Szenarien beschreiben
  • Projektanträge verfassen

Lehrinhalte

  • Innovation – Invention – Imitation
  • Arten von Innovationen, Innovationsmanagement
  • Innovationsprozess
  • Innovationszyklen
  • Innovations-Controlling
  • Schutzrechte, Patentrecht, Vertragsrecht
  • Vergabewesen und Beschaffungsprozesse, rechtlicher Hintergrund
  • Kreativitätstechniken

Vorkenntnisse

Keine. Es wird der eigenständige Umgang mit Standard-Software und Internet für Recherchetätigkeiten, erstellen von Dokumenten und Präsentationen und freier Vortrag vorausgesetzt.

Literatur

  • Disselkamp, Marcus (2012): Innovationsmanagement: Instrumente und Methoden zur Umsetzung im Unternehmen, 2. Auflage, Verlag Springer Gabler.
  • Kaschny, Martin / Nolden, Matthias (2015): Innovationsmanagement im Mittelstand: Strategien, Implementierung, Praxisbeispiele, Verlag Springer Gabler.
  • Vahs, Dietmar / Brem, Alexander (2015): Innovationsmanagement: Von der Idee zur erfolgreichen Vermarktung, 5. Auflage, Schäffer Poeschel Verlag.

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung und Abschlussprüfung

Anmerkungen

Diese Vorlesung fokussiert auf den österreichischen und europäischen Markt und dessen Strukturen

Smart City Geschäftsmodelle (SCGM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Im Zuge der Lehrveranstaltung werden die Studierenden anhand einer von ihnen gewählten Geschäftsidee aus dem Bereich Smart City ein Geschäftsmodell entwerfen. Dieses Geschäftsmodell wird, begleitet durch theoretischen input, sowohl in strategischer Hinsicht als auch in finanztechnischer Hinsicht ausgearbeitet und abgebildet. Ziel der Lehrveranstaltung ist, einen kompletten Businesscase aus dem Bereich Smart City als Geschäftsmodell darzustellen. Dies umfasst auch Darstellung eines entsprechenden Finanzierungsmodells.

Methodik

- theoretischer input zu den Themenschwerpunkten Strategieprzess, Analyse- und Portfoliotechniken, business planning, Finanzierung - Anwendung des theoretischen inputs auf die Geschäftsidee - Kurzpräsentation der jeweiligen Ergebnisse in den Lehreinheiten durch die Studierenden - Abschlusspräsentation und schriftliche Ausarbeitung des gesamten Geschäftsmodells durch die Studierenden

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Business- und Finanzpläne für Smart City Projekte zu entwerfen
  • unterschiedliche Finanzierungsmodelle zu vergleichen und zu bewerten
  • Strategieprozesse für Smart City Projekte zu designen und zu leiten

Lehrinhalte

  • Businessplan
  • Benchmarking
  • Szenario-Technik
  • Risiko-Analyse
  • PLAN-GuV, PLAN-Bilanz, PLAN-Kennzahlen
  • Finanzplan
  • Sponsoring
  • Crowdfunding
  • Strategieprozesse

Vorkenntnisse

Module Smart City Perspektive, Unternehmenskooperation

Literatur

  • Carsten, Jakob / Schramm, Dana Melanie (2014): Startup-Crowdfunding und Crowdinvesting: Ein Guide für Gründer: Mit Kapital aus der Crowd junge Unternehmen online finanzieren, Springer Gabler Verlag.
  • Nagl, Anna (2015): Der Businessplan: Geschäftspläne professionell erstellen; Mit Checklisten und Fallbeispielen, 8. Auflage, Springer Gabler Verlag.
  • Schallmo, Daniel R.A. (2013): Geschäftsmodelle erfolgreich entwickeln und implementieren: Mit Aufgaben und Kontrollfragen, Verlag Springer Gabler
  • Eschenbach Rolf / Eschenbach Sebastian / Kunesch Herrman (2008): Strategische Konzepte, 5. Auflage, Schäffer-Poeschel Verlag
  • Egger, Anton / Winterheller, Manfred (2007): Kurzfristige Unternehmensplanung, 14. Auflage, Linde Verlag

Leistungsbeurteilung

  • LV immanent

4. Semester

Bezeichnung ECTS
SWS
Modul 41 Mastermodul (MSC)
German / kMod
30.00
-
Diplomandenseminar (DIPL)
German / SE
3.00
2.00

Kurzbeschreibung

Seminar untergliedert sich in 2 Teile: 1. Teil: (a) Präsentation und (b) Verteidigung der Master Thesis durch die Studierenden auf der Grundlage der LV "Graduate Seminar"2. Teil: Schriftliche Erstellung eines Basiskonzepts durch die Studierenden auf der Grundlage der Master Thesis

Methodik

1) Präsentationen der Studierenden2) Hearing-Situationen mittels Fragen aus dem Publikum von Studierenden und Lektorenstaff im Anschluss an die Präsentation3) unmittelbare Darlegung der eigenen Lessons Learned durch die Präsentierenden mit Hilfe der Lektorenfeedbacks4) Erstellung eines schriftlichen Basiskonzepts

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • 1) eigene Forschungsresultate in Verbindung mit theoretisch begründeten Forschungsfragen und methodischen Herangehensweisen plausibel und übersichtlich visualisiert dem Zielpublikum präsentieren können2) auf vorbereitete und auch spontan gestellte Fragen aus dem Publikum (Lektorenstaff, Studierende) nachvollziehbar und engagiert eingehen können3) Basiskonzept der Master Thesis sprachlich und grammatikalisch prägnant in eine schriftliche Ausarbeitung umsetzen können4) verwendete Literaturquellen aus allen benützten Medien nach den Empfehlungen des Leitfadens Version 2012 zitieren können

Lehrinhalte

  • 1) Präsentation der eigenen Master Thesis2) Verteidigung der Master Thesis in einer Hearingsituation 3) schriftliche Formulierung des Basiskonzepts nach den Gliederungskriterien des Leitfadens zum wissenschaftlichen Arbeiten V2012

Vorkenntnisse

1) Graduate Seminar2) inhaltliche Schwerpunkte der Master Thesis3) Präsentationstechnik

Literatur

  • CIS platform: see slides 1-3Hrdina, C. and Hrdina, R., Langenscheidt Scientific English für Mediziner und Naturwissenschaftler: Formulierungshilfen für wissenschaftliche Arbeiten, Publikationen und Vorträge; [neu jetzt mehr als 1400 Beispielsätze], 2nd ed. Berlin ; Wien u.a: Langenscheidt, 2009.Skern, T., Writing scientific english: A workbook. Schlüsselkompetenzen 3112. Wien: facultas.wuv, 2009

Leistungsbeurteilung

  • 1) Beurteilung der Präsentation inklusive der Hearingsituation durch den Lektorenstaff2) Beurteilung des schriftlichen Basiskonzepts durch den Lektorenstaff

Anmerkungen

Teamteaching; Beurteilung der Outcomes durch 2 Lektoren

Master Thesis (MT)
German / BE
24.00
0.00
Scientific Writing (SCW)
English / SE
3.00
2.00