Integrative Stadtentwicklung - Smart City: Lehrveranstaltungen und Informationen zum Studium

Fakten zum Studium

  • Start: Oktober
  • Kosten pro Semester: € 363,36 Studiengebbühr, € 75,- Kostenbeitrag für Zusatzleistungen, € 19,20 ÖH-Beitrag
  • Präsenzphasen: Dienstags, Mittwochs, Donnerstags jeweils 17:50 - 21:00 plus Fernlehrunterstützung
  • 120 ECTS-Punkte
  • Möglichkeit für ein Auslandssemester


Hier finden Sie die aktuellen Lehrveranstaltungen des Studiengangs. Die Darstellung unterliegt laufenden Aktualisierungen und entspricht nicht zwangsläufig dem Studienplan für das nächste Studienjahr. Module, die sich über mehrere Semester erstrecken, werden jeweils mit der ECTS-Zahl für alle Semester angezeigt. Legende: 

  • kMod kumulatives Modul (jede LV besitzt eine eigene Prüfung)
  • iMod integratives Modul mit abschließender Modulprüfung
  • UE Übung
  • ILV Integrative Lehrveranstaltung
  • SE Seminar
  • LAB Laborstunden
  • TUT Tutorien 

1. Semester

Bezeichnung ECTS
Modul 11 Ausgleichsmodul (AMOD)
German / kMod
Grundlagen der urbanen Energieversorgung (GUE)
German / ILV, FL


Die Grundlagen der urbanen Energieversorgung spannen einen Bogen von den Grundbegiffen der Energielehre/des Energiesystems, über den Status des bestehenden städtischen Energiesystems bis hin zu den aktuellen Herausforderungen der urbanen Energieversorgung und der Gebäudetechnik.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die bauphysikalischen Grundlagen des energieeffizienten Bauens und die gebäudetechnischen Grundlagen in einfachen Beispielen anzuwenden
  • aufbauend auf den Grundbegriffen der Energielehre den aktuellen Status des städtischen Energiesystems zu beschreiben und evaluieren
  • die zukünftigen Herausforderungen des städtischen Energiesystems zu benennen und Lösungsansätze zu skizzieren


  • Grundlagen der konventionellen und erneuerbaren Energietechnologien
  • Energieversorgungskonzepte und Strukturen mit Fokus urbaner Raum
  • Bauphysikalische Grundlagen, Grundlagen der Energieversorgung im Gebäude
  • Grobe Anlagendimensionierung Erneuerbare Energietechnologien, Ener0giebedarfsberechnungen von Gebäuden, Energetische Bewertung von Energietechnologien und Gebäuden


Naturwissenschaftlich-technisch-physikalisches Grundlagenwissen


  • Quaschning / Voljer (2015), Regenerative Energiesysteme, Hanser
  • Recknagel / Sprenger / Alber (2015), Taschenbuch für Heizung + Klimatechnik 2015/2016, DIV
  • Riccabona, Christof / Bednar, Thomas (2010): Bauphysik; Manz


  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Grundlagen des Verkehrswesens (GVW)
German / ILV, FL


Die Lehrveranstaltung dient der Einführung in die Themen Mobilität und Verkehr. Die wichtigsten Grundlagen im Bereich der Verkehrsplanung werden mittels Vorlesungen und Übungen vermittelt. Die Lehrveranstaltung wird mit einer schriftlichen Prüfung abgeschlossen.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Zusammenhänge von Kenngrößen des Verkehrsablaufs zu beschreiben
  • Verkehrsplanerische Begrifflichkeiten, Dokumente, Analysen zu verstehen und zu hinterfragen
  • gängige Erhebungsmethoden im Verkehrswesen (z.B. Zählungen, Befragungen) sowie deren Anwendungsfelder zu beschreiben
  • gängige Darstellungsformen von Mobilitäts-/Verkehrsdaten zu beschreiben und die Daten zu interpretieren.
  • Grundsätze für die Gestaltung von ÖPNV-Systemen zu erläutern (Basiswissen)
  • den Planungsablauf zu beschreiben und Instrumente zur Beurteilung von Maßnahmen anzuwenden (Basiswissen)
  • Umweltauswirkungen von Verkehr benennen (Basiswissen)
  • Elemente der Querschnittsgestaltung von Straßen zu beschreiben


  • Verkehrsplanung: Grundlagen und Begriffe
  • Verkehrsangebot, Einführung ÖPNV, Verkehrsnachfrage
  • Planungsablauf, Entscheidungshilfen
  • Verkehrserhebungen
  • Verkehrssicherheit
  • Überblick Umweltwirkungen
  • Einführung in die Straßenplanung: Verkehrsablauf auf der freien Strecke, Querschnittsgestaltung von Straßen




  • Höfler, Frank (2006), Verkehrswesen-Praxis, Band 1: Verkehrsplanung, Beuth
  • Höfler, Frank (2006), Verkehrswesen-Praxis, Band 2:: Verkehrstechnik Beuth
  • Winfried, Reinhardt (2012): Öffentlicher Personennahverkehr – Technik – rechtliche und betriebswirtschaftliche Grundlagen, Vieweg+Teubner Verlag-Springer Fachmedien, Wiesbaden GmbH
  • Schnabel, W.; Lohse, D. (2011) Straßenverkehrstechnik, Band 1 und 2
  • Jeweils angegebene Regelwerke (RVS etc.)


Moodlekurs beachten

IT Netze und Datenmanagement (ITN)
German / ILV, FL


In der Lehrveranstaltung lernen die Studierenden die Grundlagen der Netzwerktechnik (kabelgebunden, kabellos) sowie die Grundlagen von relationalen Datenbanken.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • ER Diagramme zu erklären
  • eine Relationale Datenbank mittels SQL zu befüllen, zu verändern und abzufragen
  • die wichtigsten Protokolle das OSI Layer Model inkl. Vor- und Nachteile, zu benennen
  • IPv4- und IPv6-Adressen zu kategorisieren


  • Grundlagen Netzwerktechnik
  • ISO/OSI Modell und Protokolle
  • IP Adressen (IPv4 und IPv6)
  • Domain Name System
  • Definition und Spezifikation relationaler Datenbanken
  • Entwurf semantischer und physikalischer Datenmodelle
  • Datenmodellierung mit ER-Diagrammen
  • Basics in SQL (DDL, DML, DCL)




  • Tanenbaum, Andrew S. / Hübner, C. (2012), Computernetzwerke: Pearson Studium; Auflage: 5., aktualisierte Auflage
  • Elmasri, R.A. / Navathe, S.B. / Shafir, A. (2011): Grundlagen von Datenbanksystemen, Bachelorausg., 3., aktualisierte Aufl., ed, IT - Informatik. Pearson Studium, München
  • Faeskorn-Woyke, H. (Ed.) (2007): Datenbanksysteme: Theorie und Praxis mit SQL2003, Oracle und MySQL, IT - Informatik. Pearson Studium, München.
  • Häckelmann, Heiko. (2013). Kommunikationssysteme: Technik und Anwendungen. Springer
  • Kemper, A. / Eickler, A. (2013): Datenbanksysteme: eine Einführung, 9., erweiterte und aktualisierte Auflage. ed. Oldenbourg verlag, München
Modul 12 Urbane Mobilität (UMOB)
German / kMod
Städtisches Mobilitätsmanagement (SMM)
German / ILV, FL


Ausgehend von städtischen verkehrspolitischen Zielsetzungen werden die Instrumente und Herangehensweisen erarbeitet, mit denen die Zielsetzungen erreicht werden können. Augenmerk liegt auf den Handlungsspielräumen der einzelnen Stakeholdern in der Entscheidungshierarchie.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Top-Down Ansätze zu verfolgen um geeignete Maßnahmen und Kombinationen aus Maßnahmen zu verkehrspolitischen Zielsetzungen zu beschreiben
  • Die Wirkung von Mobilitätsmaßnahmen zu beurteilen, um diese als Instrument in der urbanen Verkehrssteuerung gezielt einsetzen zu können
  • Die Wechselwirkung von Maßnahmen und Maßnahmenbündeln beurteilen zu können um effektive Maßnahmenbündel zu beschreiben
  • Die Rolle der Stakeholder in den einzelnen hierarchischen Niveaus der Verkehrspolitik und deren Umsetzung zu analysieren und zu beschreiben
  • Verkehrspolitische Ziele zu analysieren sowie deren Umsetzungsqualität zu beurteilen


  • Hierarchisches Multi-Layer Modell „Politik – Taktik – Maßnahme – Betrieb“
  • Rollen und Verhalten der Akteure im urbanen Mobilitätsmanagement
  • Verkehrspolitische Zielsetzungen und deren Erreichung
  • Bildung von Szenarien als Instrument zur Mobilitätsbeeinflussung
  • Maßnahmen zur Mobilitätsbeeinflussung, deren Wirkung sowie deren Abhängigkeiten in einem Maßnahmen-Mix
  • Die Rolle der Technologie sowie von zukünftigen Anwendungen wie C-ITS
  • Bewertung Wirkung, Zielerreichung und Umsetzungsqualität von Maßnahmen




  • Adamski A., Kwasniak A. (2007): ITS – Hierarchical Multi-Layer System Traffic Safety Option, ITS ILS 2007, ISBN 978-83-88309-86-1
  • Dix, Michelle (2002): The Central London Congestion Charging Scheme – From Conception to Implementation. IMPRINT-EUROPE Thematic Network Seminar, Brussels
  • Europäische Kommission (2013): IVS-Expertengruppe für Urbane Bereiche, Guidlines for ITS deployment in Urban Areas
  • Europäische Kommission (2013): Best Practices in Urban ITS -Collection of Projects
  • ISIS, PWC (2010): Study on Urban Access Restrictions
  • Jesty P., Giezen J., Gaillet J., Durand J., Avontuur V., Bossom R., Franco G., KAREN – European ITS Framework Architecture, Models of Intelligent Transport Systems, KAREN TR 4108, Document Nr. D3.7
  • KU Leuven (2013): UITP, Study on Harmonised Collection of European Data and Statistics in the Field of Urban Transport and Mobility, 2013
  • Leihs, D. (2013): Key Performance Indicators as a Decision Support for Urban Traffic Planning, European ITS Conference Dublin, Ireland, TP0090
  • Leihs, D., Siegl, T., Hartmann, M. (2014): Nutzen und Technologien von Systemen zum Steuern der Zufahrt in urbane Zonen Stadtmaut – Umweltzonen - Zonen mit begrenzter Zufahrt, Springer Vieweg, ISBN 978-3-658-03785-7
  • McLeod, Kenneth; Healy, Seamus (2006): A business management approach to transport – Some lessons learned from congestion charging in Edinburgh. In: European Transport Conference
  • Purd’Homme, Remy; Bocarejo, Juan Pablo. (2005): The London congestion charge: a tentative economic appraisal. In: Transport Policy, Volume 12 Nr.3, S. 279-287
  • Rupprecht Consult GmbH (2012): Leitfaden für nachhaltige urbane Verkehrsplanung
  • Rupprecht Consult GmbH (20013): Pläne für die Nachhaltige urbane Mobilität
  • Siegl, T., Leihs, D., Trapuzzano, A. (2012): Eco Traffic Management in Cities, ITS World Congress Vienna, EU00636
Urbanes Verkehrsaufkommen (UVA)
German / ILV, FL


Die Lehrveranstaltung gibt einenen Überblick zu den Themen Smart city und motorisierter Verkehr. Dies beinhaltet planerische Aspekte beim motorisierten Individualverkehr und öffentlichen Verkehr, die Diskussion von Auswirkungen und die Beurteilung von Maßnahmen.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Grundsätze und Einflussgrößen für die Anwendungsbereiche von Telematik im ÖPNV zu erläutern
  • die Grundlagen, die für die Anwendung im System ÖPNV relevant sind zu beschreiben und deren Relevanz für die Planung zu nennen.
  • mögliche Auswirkungen auf das Gesamtsystem hervorgerufen durch Veränderungen im Verkehrssystem (z.B. durch Einführung einer neuen Verkehrstechnologie oder Straßenbenützungsabgabe) zu erkennen und grob zu analysieren.
  • Möglichkeiten zur Steuerung des ruhenden Verkehrs zu erläutern
  • wesentliche Umweltwirkungen von Straßen(-verkehr) zu benennen
  • Kapazitäten der Verkehrsinfrastruktur baschätzen zu können


  • Betriebliche Grundlagen im ÖPNV
  • Steuerung und Überwachung von ÖPNV-Systemen
  • Fahrgastinformation im ÖPNV
  • Verkehrsinformationssysteme
  • Intermodalität
  • Verkehrswirtschaft
  • Umweltauswirkungen von Verkehr
  • Beurteilung von Verkehrsinfrastrukturprojekten (im Sinne der Nachhaltigkeit) Verkehrsleit- und Informationssysteme
  • Stellplatzmanagement


Bachelor im Bereich Verkehr/Mobilität oder Ausgleichsmodul Lehrveranstaltung Grundlagen des Verkehrswesens


  • begleitende Übungen in Kleingruppen
  • schriftliche Prüfung
Modul 13 Wahlmodul 1 (WMOD1)
German / kMod
Modul 13a AK1 - Urbaner Gebäudebestand (AK13a)
German / kMod
Energetische Quartierssanierung (AK1EQS)
German / ILV, FL


Grundlagen in der räumlichen und energetischen Analyse von urbanen Quartieren; Einflussfaktoren der Rahmenbedingungen auf den Energieverbrauch; Methodische Ansätze zur Erstellung von energetischen Sanierungskonzepten im urbanen Raum


Integrierte LV, Vorträge, Gruppenarbeit


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Sanierungspotentiale im Gebäudebestand zu analysieren
  • Energetische Sanierungsvarianten für die Quartierssanierung zu definieren


  • Bedarfsanalysen des Gebäudebestands
  • Energierelevante Maßnahmenbündel für unterschiedliche Gebäudetypologien
  • Sanierungskonzepte für Quartiere


Grundlagen und Definition von Smart City Einflussfaktoren Team-Work Kompetenzen Grundlagen des wissenschaftlichen Arbeitens


  • Literatur / Referenzen werden in den Unterrichtseinheiten zur Verfügung gestellt


  • 50% Gruppenarbeit / 50% Abschlussprüfung
Nachverdichtung im urbanen Raum (AK1NUR)
German / ILV, FL


Integrative Stadtentwicklung im Sinne einer Smart City funktioniert nur in einer sinnvollen Kombination zwischen planerischen Konzepten und technischen Lösungen. Ein stadtplanerisches Konzept stellt die Nachverdichtung urbaner Strukturen dar. Die bereits gebaute Stadt bietet in baulich-räumlicher Sicht große Potentiale zur Energieeinsparung. Wie diese Potentiale durch strategische Konzepte, konkrete Umsetzungsansätze und passend auf den jeweiligen Stadtraum erfolgreich umgesetzt werden kann, wird in dieser Lehrveranstaltung behandelt. Besonderes Augenmerk wird auf die vorhandenen städtebaulichen Strukturen und die energiesparende Quartiersplanung an sich gelegt. Es werden bestehende Stadtmorphologien verglichen und bestehende Konzepte zur Nachverdichtung behandelt sowie eigene Gedanken dazu formuliert.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Einflussfaktoren der Stadtmorphologie auf den urbanen Energieverbrauch zu beschreiben
  • Nachverdichtungskonzepte im urbanen Raum zu vergleichen und ein eigenes Konzept zu erstellen


  • Auswirkung der Stadtmorphologie auf den urbanen Energieverbrauch
  • Gebäudetypologien im urbanen Kontext
  • Zielsetzungen und Maßnahmen zur Nachverdichtung




  • Literaturstudium und anschließende Präsentation in der Lehrveranstaltung
  • Seminarabschlussarbeit


Die zu erbringenden Leistungen werden in Gruppenarbeit erstellt.

Modul 13b AK1 - Trends der urbanen Energieversorgung (AK13b)
German / iMod
Trends der urbanen Energieversorgung (AK1TUE)
German / ILV, FL


Die Lehrveranstaltung baut auf die Grundlagenvorlesung der urbanen Energieversorgung auf und vertieft Inhalte in den Bereichen der urbanen, erneuerbaren Energietechnologien und Energieversorgung von Gebäuden und Stadtquartieren. Erweiternd wird auf regulatorische Rahmenbedingungen, Wirtschaftlichkeitsaspekte und Lebenszykusbetrachtungen, sowie auf Fragestellungen der sozialen Akzeptanz eingegangen.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • ein ganzheitliches Verständnis für energierelevante Fragestellungen im städtischen Raum zu entwickeln und anhand von beispielhaften Projekten umzusetzen
  • neue Technologieentwicklungen und veränderte Rahmenbedingungen in Bezug auf deren Auswirkungen in städtischen Strukturen zu bewerten
  • Gesellschaftliche und soziale Aspekte in zukünftigen Energiesystemen zu bewerten und die Anforderungen unterschiedlicher Interessensgruppen entsprechend einzuordnen
  • Wirtschaftlichkeits- und Lebenszyklusbetrachtungen von ausgewählten Energie-Projekten durchzuführen


  • Strategien und Trends der städtischen Energieversorgung
  • Herausforderungen beim Umbau zu einer erneuerbaren städtischen Energieversorgung
  • Rechtliche und regulatorische Rahmenbedingungen
  • Wirtschaftlichkeits- und Lebenszyklusbetrachtungen von ausgewählten Projekten
  • Fragestellungen der sozialen Akzeptanz und Diversitätsaspekte


Grundlagen der urbanen Energieversorgung


  • Cave / Cochrane, (2014), Mapping Smart Cities in the EU
  • Droege (2011): Urban Energy Transition: From Fossil Fuels to Renewable Power, Elsevier Verlag
  • Morata / Sandoval (2012): European Energy Policy: An Environmental Approach, Edward Elgar Publishing
  • Tagungsband Smart City Week 2015


  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Modul 13c AK1 - Physikalische Messtechnik (AK13c)
German / iMod
Physikalische Messtechnik für Smart Cities (AK1PMT)
German / ILV, FL


Die Lehrveranstaltung zeigt Möglichkeiten der Messung physikalischer Größen, die im Smart City Umfeld benötigt werden.


Vorlesung mit integrierten Übungsanteilen, Labor und Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Messgrößen, die in der Smart-Cities-Thematik von besonderer Bedeutung sind, physikalisch und statistisch korrekt aufzunehmen
  • Messwerte statistisch korrekt zu verarbeiten und auszuwerten. in gegebenen praktischen Situationen geeignete Messmethoden auszuwählen und diese anzuwenden
  • die Bedeutung von Messfehlern und deren Auswirkungen zu beurteilen
  • Messfehler für physikalische Messgrößen aus Toleranzen von Messgeräten zu bestimmen


  • Struktur einer Messeinrichtung
  • Systematische und statistische Messfehler
  • Fehlerfortpflanzung
  • Messverfahren für Temperatur
  • Messverfahren für Energie
  • Messverfahren für Leistung
  • Messverfahren für Wärmemengen
  • Messverfahren für Umweltgrößen
  • Messverfahren für Licht
  • Auswerte-Methoden für Messgrößen


Grundlagen der Physik und Elektrotechnik


  • Kunze, H.J. (1986): Physikalische Messmethoden, Teubner
  • Lerch, R. (2007): Elektrische Messtechnik: Analoge, digitale und computergestütze Verfahre, Springer
  • Lindner, G. / Niebuhr, J (2001): Physikalische Messtechnik mit Sensoren, Oldenbourg
  • Versuchsanleitungen
Modul 13d AK1 - Embedded Systems (AK13d)
German / iMod
Embedded Systems (AK1ES)
German / ILV, FL


Einführung in das hardwarenahe Programmieren von Mikrocontrollern.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Eigenschaften und Besonderheiten von Embedded Systems zu beschreiben
  • eine Integrierte Entwicklungsumgebung für das Programmieren und Debuggen von Embedded Systems Software einzusetzen
  • hardwarenahe modulare Software in C für Embedded Systems zu entwerfen und zu schreiben
  • typische Peripherieeinheiten eines Mikrocontrollers für die Anbindung von Sensoren und Aktoren einzusetzen


  • Aufbau, Eigenschaften und Besonderheiten von Embedded Systems
  • Aufbau und Funktion von Mikrocontrollern
  • Arbeiten mit einer Integrierten Entwicklungsumgebung für Mikrocontroller
  • Debugging von Embedded Systems Software
  • Softwareentwurf in C für Embedded Systems, modulare Software
  • Zugriff auf I/O-Ports, Bit-Manipulation in C
  • Behandlung von Ereignissen in Interrupt Service Routinen
  • Timer/Counter-Einheit
  • Serielle digitale Interfaces (z.B. RS232, SPI, I2C)
  • weitere Peripherieeinheiten (z.B. ADC, PWM, DMA, ...)
  • Projektarbeit


Programmiersprache C


  • Skriptum C167, C167 User Manual, Studienbriefe, Simulationstool
  • Valvano, J. (2012): Embedded Systems: Introduction to Arm Cortex-M Microcontrollers, CreateSpace Independent Publishing Platform; 5th edition
  • White, E. (2011): Making Embedded Systems: Design Patterns for Great Software, O'Reilly Media; 1st edition


  • schriftlicher Test, Projektarbeit im Team
Modul 13e AK1 - Human Factors in der Mobilität (AK13e)
German / kMod
Faktor Mensch in der Mobilität (AK1HUM)
German / ILV, FL


Diese Vorlesung befasst sich mit den menschlichen Faktoren, die das Mobilitätsverhalten der VerkehrsteilnehmerInnen beeinflussen. Daraus werden Kenntnisse über verschiedene Ansätze zur besseren Nutzung der Stadtinfrastruktur und Transportsysteme gewonnen. Ebenso werden die Auswirkungen der Einführung neuer Technologien im Fahrerverhalten berücksichtigt.


Vorlesung mit integrierten Übungsanteilen, Gruppenarbeit und Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • menschliche Faktoren, die den Verkehr beeinflussen, zu beschreiben
  • Mobilitätsprobleme zu analysieren und potentielle Lösungen vorzuschlagen
  • Faktoren, die menschliche Mobilität beeinflussen, zu spezifizieren
  • Methoden zur Datenerfassung und -verarbeitung auf der Grundlage geeigneter Technologien und des spezifischen Anwendungsfalles zu entwerfen


  • Menschliche Faktoren, die Intelligente Verkehrssysteme beeinflussen
  • Methoden, die menschlichen Faktoren für eine intelligente Mobilität berücksichtigen.
  • Faktoren, die die Mobilität der Menschen beeinflussen


Grundlagen des Verkehrswesens


  • Understanding individual human mobility patterns, MC Gonzalez, CA Hidalgo, AL Barabasi, Nature 453 (7196), 779-782
  • The ‘Roadmap to a Single European Transport Area - Towards a competitive and resource efficient transport system’,
  • The Human Factors of Transport Signs, edited by Candida Castro,Tim Horberry
  • Human Factors in Intelligent Transportation Systems, Woodrow Barfield, ‎Thomas A. Dingus – 2014;


  • Präsentationen, Gruppenarbeit, Prüfung
Verkehrssicherheit (AK1VSICH)
German / ILV, FL


Die Lehrveranstaltung soll einen Überblick über die Grundlagen der Straßenverkehrssicherheitsarbeit vermitteln. Darauf aufbauend werden mit den Studierenden anhand zahlreicher praktischer Beispiele konkrete Maßnahmen und deren Wirkungen diskutiert.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Wirkung von (vorrangig technischen) Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt grob abzuschätzen
  • Forschungsmethoden aufzuzählen und zu erklären, die für die genaue Feststellung der Wirkungen von Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt zur Verfügung stehen
  • Datenquellen aufzuzählen und zu erklären, die bei der Feststellung der Wirkung von Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt benutzt werden können
  • verschiedene Methoden der Priorisierung von Maßnahmen zu nennen und deren Vor- und Nachteile zu beschreiben
  • typische Verhaltensweisen von Menschen im Straßenverkehr aufzuzählen und zu erläutern, anhand derer der Umgang von Verkehrsteilnehmern mit unterschiedlichen Maßnahmen erklärt werden kann
  • für Teilbereiche der Verkehrssicherheitsarbeit (z.B. für Verkehrsteilnehmergruppen) vertieft spezifische Probleme zu identifizieren und Maßnahmen vorzuschlagen


  • Überblick über das Verkehrsgeschehen in Österreich und auf Europäischer Ebene
  • Quantifizierung des Unfallgeschehens: Datenerfassung, Datenspeicherung, Datenauswertung
  • Aspekte des Verhaltens von Verkehrsteilnehmern
  • Methoden der Verhaltensforschung bei Verkehrsteilnehmern
  • Datenquellen für Sicherheits-, Verkehrs- und Umweltdaten
  • Methoden der Priorisierung von Maßnahmen auf integrierter Basis von Sicherheits-, Verkehrs- und Umweltdaten


keine erforderlich


  • Elvik, R. / Hoye, A. / Vaa, T. / Sorensen, M. (2009): The Handbook of Road Safety Measures, 2nd Edition, Emerald Publishing Group Limited, ISBN 978-1-84855-250-0
  • European Road Safety Observatory
  • Herry et al (2007): Unfallkostenrechnung Straße 2007, Forschungsarbeiten aus dem Verkehrswesen Band 177, Bundesministerium für Verkehr, Innovation und Technologie, Wien
  • Höhnscheid et al (2005): ROSEBUD: Framework for Efficiency Assessment, Handbook of Assessed Road Safety Measures; Demonstration Course, Bergisch-Gladbach.
  • OECD/ECMT (2006): Speed Management. ISBN 92-821-0377-3 Robatsch, K. / Schrammel, E. (2001): Grundlagen der Verkehrssicherheit. IVS-Schriftenreihe, Band 13. TU-Wien
  • SUPREME Final Report Part C: Handbook For Measures At The Country Level, KFV, 2007
  • SUPREME Final Report Part D: Handbook For Measures At The European Level


  • schriftliche Prüfung
  • eine schriftliche Seminararbeit
  • sowie LV-immanent (aktive Mitarbeit)
Modul 13f AK1 - Treibhausgasreduktion (AK13f)
German / iMod
Treibhausgasreduktion (AK1THGR)
German / ILV, FL


Die Lehrveranstaltung zegt die Arten und Ansätze zur Vermeidung von Treibhausgasen, es wird auch auf die rechtlichen Aspekte eingegangen.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Quellen von Treibhausgasen in Städten mit Hinblick auf ihr Emissionsverhalten zu beurteilen
  • die Interdependenzen unterschiedlicher Emissionsquellen zu bewerten
  • die Maßnahmen zur Verringerung von Treibhausgasen zu beurteilen
  • die nationalen Verpflichtungen zum Erreichen von Emissionszielen mit Hinblick auf supranationale, nationale und regionale Maßnahmen zu bewerten


  • Wirkung und Arten von Treibhausgasen
  • Internationale Vereinbarungen und Bestrebungen zur THG-Verringerung
  • Quellen von Treibhausgasen sowie deren Trend
  • Lokale Maßnahmen zum Verringern von Treibhausgasen in Städten, insbesondere Heizung, industrielle Prozesse und Mobilität
  • Interdependenz von Maßnahmen zur THG-Verringerung




  • Climate Change 2013, The Physical Science Basis, Cambridge University Press
  • Europäische Kommission (2014): Klimaschutz, ISBN 978-92-79-41340-7
  • Europäische Kommission (2014): Conclusion EUCO 169/14
  • Europäische Kommission (2013): The EU Emission Trading System (EU ETS), 2013
  • European Commission (2012): Richtlinie des Europäischen Parlamentes und des Rates, Nr. 2012/27/EU („Energieeffizienzrichtlinie“)
  • Europäische Kommission (2011): Weissbuch - Fahrplan zu einem einheitlichen europäischen Verkehrsraum – Hin zu einem wettbewerbsorientierten und ressourcenschonenden Verkehrssystem: KOM(2011) 144 endgültig
  • KU Leuven, UITP (2013): Study on Harmonised Collection of European Data and Statistics in the Field of Urban TraCnsport and Mobility
  • Umweltbundesamt (21013):Klimaschutzbericht 2013
  • Umweltbundesamt (2015): GHG Projections and Assessment of Policies and Measures in Austria, 2015
  • UN (2014): UN Climate Summit 2014, Cities Mayors Compact Action Statement
  • UN (1998): UN Kyoto Protocol to the United Nations Framework Convention on Climate Change
Modul 14 Projekt 1 (PRJ1)
German / kMod
Interdisziplinäre Teamarbeit (ITEAM)
German / SE


Die Lehrveranstaltung vermittelt den Studierenden theoretische Kenntnisse zur interdisziplinären Teamarbeit und bereitet sie darauf vor diese im beruflichen Kontext umzusetzen. Die persönliche Reflexion, das Behandeln von Fallbeispielen und das Üben von Verhaltensmöglichkeiten stehen im Mittelpunkt.


Vorlesung mit integrierten Übungsanteilen


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Kommunikationsverhalten in interdisziplinären Gesprächen anhand theoretischer Erkenntnisse (z.B. unterschiedliche Überzeugungen, Hierarchien und Professionszentrismus) zu beschreiben und zu erläutern.
  • konkrete Verhaltensalternativen für eine erfolgreiche Zusammenarbeit in interdisziplinären Teams (z.B. Perspektivenwechsel, Sprachanpassung, mediatorische Gesprächsführung) fallbezogen zu entwickeln und in einfachen Übungen anzuwenden
  • Arten, Ursachen und die verschiedenen Stufen eines Konfliktes insbesondere in einem interdisziplinären Kontext (z. B. nach dem Eskalationsmodell von Glasl) zu beschreiben und Instrumente der Deeskalation (z. B. Selbsthilfe, Moderation) anzuwenden.


  • Multi-, Inter- und Transdisziplinarität
  • Herausforderungen in der interdisziplinären Teamarbeit
  • Kriterien und Kompetenzen für erfolgreiche interdisziplinäre Teamarbeit
  • Identität und Selbstkonzept
  • Überblick zu Theorien der Gruppendynamik
  • Kommunikation und Gesprächsführung
  • Grundlagen zur konstruktiven Gestaltung von Konfliktsituationen




  • Glasl, Friedrich (2008): Selbsthilfe in Konflikten, 5. Auflage, Stuttgart: Verlag Freies Geistesleben/Haupt
  • Haeske, U. (2008): Teamentwicklung, Berlin: Cornelsen Verlag, [bilingual book: in English and German]
  • Simon, Walter (2007): GABALs großer Methodenkoffer: Grundlagen der Kommunikation, Offenbach: Gabal Verlag
  • weitere Literatur zu interdisziplinären Teams


  • LV-Immanente Leistungsbeurteilung und Prüfung (Note)



Projektarbeit 1 (PRJ1)
German / PRJ


Analyse und Spezifikation eines Projekts im (interdisziplinären) Smart City Umfeld




Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • anhand einer Problemstellung einen State of the art Bericht zu erstellen und eine Marktanalyse durchzuführen
  • Anwendungsszenarien und funktionale Anforderungen zu definieren
  • Vision, Beschreibung, Ziele und Projektumfeld zu formulieren und eine erste Version eines Projekthandbuches zu erstellen
  • Resultate in Form eines wissenschaftlichen Papers darzustellen


  • Umsetzung von Projekten in Teamarbeit (nach Möglichkeit mit einer interdisziplinären Teamzusammenstellung)
  • Führen eines Projekthandbuchs
  • State of the art Analyse (wissenschaftlich, technisch)
  • Marktanalyse
  • Definition von Anwendungsszenarien (inklusive organisatorischer Rahmenbedingungen)
  • Funktionale Anforderungen
  • Projektmanagement


Grundlegendes Verständnis von Projektmanagement, technische Vorkenntnisse je nach Projektthema


  • Abhängig vom Projektthema


  • LV-Immanent, Documentation, Präsentationen, Paper
Modul 15 Smart City Perspektive (SCP)
German / kMod
Smart City Trends (SCT)
German / ILV, FL


Es wird der Zusammenhang von Smart-City-Konzepten, den hierbei entstehenden Berufsfeldern und den künftig dafür notwendigen Kernaufgaben und Kerntätigkeiten erläutert. Berufliche Kernkompetenzen für die beruflichen Positionen und Funktionen zur Ermöglichung einer integrativen Stadtentwicklung werden anhand des Smart City Konzeptes schriftlich mit den Studierenden ausgearbeitet und beurteilt.


Vorlesung mit integrierten Übungsanteilen


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • unterschiedliche Smart-City-Konzepte darlegen und auf ihre sozio-technologische Ausgewogenheit hin einordnen zu können
  • einen Überblick über die Berufsfelder im Kontext des Smart City Ansatzes darlegen und auf ihre künftigen Entwicklungen hin analysieren zu können
  • Kernkompetenzen integrativer Stadtentwicklung zu definieren und auf horizontale Schnittstellenanforderungen zu übertragen
  • Berufsbilder für Positionen und Funktionen im Kontext eines Smart City Konzeptes schriftlich ausarbeiten zu können


  • Konzepte des Smart City Ansatzes sowie urbane Systemarchitekturen
  • Berufsfeldmodelle zur Analyse beruflicher Smart City Trends
  • Berufsfelder im Rahmen von Smart City mit dem integrativen Fokus von Mobilität – Energie - IKT
  • integrative Kernkompetenzen für den Aufbau bzw. die Stabilisierung von Smart-City-Projekten
  • Ausarbeitung bzw. Adaption von (bestehenden) Berufsbildern/ Stellenprofilen hin zur Weiterentwicklung von Smart-City-affinen Tätigkeitsfeldern (Arbeitsplätzen)




  • Guenter Essl (2015). The ‘profession/ occupation field model’ as an activity theoretical framework for the development of engineers in the context of the Smart City approach.
  • Etezadzadeh (2015). Smart City - Stadt der Zukunft? - Die Smart City 2.0 als lebenswerte Stadt und Zukunftsmarkt (essentials). (1st ed.): Springer Vieweg
  • Jaekel, M. (2015). Smart City wird Realität. (1. Aufl. 2015): Springer Vieweg.
  • Stögerer, M., Müller, J., & Jutz, K. (2015). Smart City. Kritische Analyse des Konzepts: Grin Verlag.
  • Stroschein, C. (Ed.) (2014). Smart City: Die Zukunft der Stadt Trends und Entwicklungen. (1., Aufl.): Beuth.


  • Additive Aufgabenstellungen über das Gesamtsemester hinweg
Stadtprozesse (SPZ)
German / ILV, FL


Ausgehend von einer Einführung in das Standortproblem werden unterschiedliche theoretische Ansätze angerissen. Zum einen solche, die die Transportkosten in den Vordergrund stellen (neoklassische), zum anderen auch jüngere Ansätze, die stärker die Rolle von Arbeitskräften, Information sowie von Organisation und Technologie betonen. Das Zusammenwirken von beteiligten Akteuren wird beleuchtet, zusätzlich werden die Strukturen der Bodennutzung innerhalb von Städten als auch das gesamte städtische System beleuchtet. Es erfolgt eine Darstellung der organisatorischen, rechtlichen und technischen Rahmenbedingungen der elektronischen Wechselwirkung zwischen Behörden einerseits und Unternehmen bzw. Bürgern andererseits.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Grundlegende Prinzipien nachhaltiger Stadtökonomie erklären und diskutieren
  • Prinzipien und Strategie des österreichischen E-Government benennen
  • Einflussfaktoren auf die Standortwahl identifizieren und quantifizieren
  • Stakeholder und ihre Interessen analysieren


  • Grundlagen der Stadtökonomie: Bildung, Sicherheit, Wohnungsmarkt, Nutzbarkeit des öffentlichen Raums, Umweltschutz
  • Urban Governance: Stadtpolitik, Bürgerrechte, Verwaltungsökonomie
  • E-Government, Prozesse und Realisierungen
  • Städtische Stakeholderprozesse




  • Amey, F. / Ringel, J. (2014): Hotspots der Stadtentwicklung: Methoden, Praxis und Perspektiven der gemanagten Stadt
  • Hentze, J. / Thies, B. (2014): Stakeholder-Management und Nachhaltigkeits-Reporting
  • Plattform Digitales Österreich,
  • Ruby, I. / Ruby, A. (2014): The Economy of Sustainable Construction, Ruby Press
  • Van Der Heijden, J. (2014): Governance for Urban Sustainability and Resilience: Responding to Climate Change and the Relevance of the Built Environment, Edward Elgar Publishing Ltd
  • Maier, G./Tödtling, F. (2006): Regional- und Stadtökonomik


  • LV-immanente Leistungsbeurteilung (Ausarbeitung und Präsentation)

2. Semester

Bezeichnung ECTS
Modul 21 Urbane Erneuerbare Energie (AMOD)
German / kMod
Energieinfrastruktur (EINF)
German / ILV, FL


Die grundlegenden Auslegungsgrößen einer Energieversorgungsinfrastruktur werden am Beispiel eines Fernwärmenetzes vermittelt. Das Stromnetz mit seiner steigenden Bedeutung als Energieträger wird genauer in seiner aktuellen Entwicklung hin zu einem Digitalen Netz beleuchtet und die Modellierung im Smart Grid Architektur Modell vermittelt.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die grundlegenden Parameter zur Auslegung einer Energieinfrastruktur zu kennen und abzuleiten
  • die Struktur der zukünftigen Strominfrastruktur zu beschreiben (Smart Grids Architektur Modell), exemplarische Anwendungsfälle und Rollen sowie betriebliche Rahmenbedingungen zu kennen


  • Auslegung einer Fernwärmeversorgung
  • Komponenten des elektrischen Stromnetzes
  • Struktur des Strommarktes, Entbündelung
  • Aktuelle Herausforderungen im Detail
  • Smart Grids Architektur Modell (SGAM)


Naturwissenschaftlich- technisch-physikalisches Grundlagenwissen


  • Das Österreichische Strommarktmodell, E-Control, 2013
  • Berger (2014), Smart Grid Technologie Roadmap
  • Richtlinie 2009/72/EG DES EUROPÄISCHEN PARLAMENTS UND DES RATES vom 13. Juli 2009 über gemeinsame Vorschriften für den Elektrizitätsbinnenmarkt
  • CEN - CENELEC - ETSI Smart Grid Coordination Group - Smart Grid Reference Architecture
  • Smart Grid Standards Map, IEC International Electrotechnical Commission


  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Energieversorgung von Gebäuden und Quartieren (EGQ)
German / ILV, FL


Die Energieversorgung von Gebäuden und Quartieren wird in den wesentlichen Systemlösungen dargestellt. Es werden die wesentlichen Einflussfaktoren und Maßnahmen bearbeitet: Komfort-Energiebedarf-Energiedeckung, Status Quo - Best Practice; Bestandssanierung-Neubau; Wohnen-Büro-Bildung; Nutzenergieabgabe, Energieverteilung, Energieeffiziente Systeme, konventionelle und erneuerbare Systeme. Im Mittelpunkt stehen energieautonome, bzw. CO2-neutrale Versorgungskonzepte. Diese werden anhand eines Übungsbeispiel im urbanen Bestand verdeutlicht: Mehrfamilienhaus nachverdichtet im Gründerzeitquartier


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Energieeffiziente Versorgungsstrukturen für Gebäude und Gebäudekomplexe entwerfen und deren ökologische Belastung (z.B. PEB, THG) in der Betriebsphase vereinfacht bewerten zu können


  • Gebäudetypologien (Niedrigenergie-, Passivhaus, Plusenergiegebäude)
  • Komfort und NutzerInnenakzeptanz
  • Energetische Sanierungskonzepte
  • Energieversorgungskonzepte für Gebäudekomplexe und Quartiere
  • Vereinfachte Nachhaltigkeitsbewertung von Gebäuden und Quartieren


Typische Kennzahlen aus der Stadtplanung (GFZ etc.) Konzept Energiedienstleistung, Energiebedarf, Energiedeckung, Primärenergiedeckung


  • Daniels, Klaus (2001): Gebäudetechnik – Ein Leitfaden für Architekten und Ingenieure; Oldenbourg
  • Wosnitza, F. / Hilgers, H. G. (2012):Energieeffizienz und Energiemanagement, Springer
  • IBO – Institut für Bauen und Ökologie Hrsg (2016): Passivbauteilkatalog Sanierung; Birkhäuser (Energieeffizienz in der Bestandssanierung)
  • BMVIT 2015: Wärmenetz der Zukunft; Eigenverlag (gebäudeübergreifender Wärmeaustausch)
  • Schneider, U. / Zelger, T. / Böck, M. / Holweck, A. (2013): Plusenergiestandard für das Gründerzeithaus Cafe Weidinger, Lerchenfelder Gürtel; Haus der Zukunft
  • Zach, F. (2016): Innovative Konzepte zur Versorgung großvolumiger städtischer Gebäude/Quartiere mit PV und Geothermie, Stadt der Zukunft
  • Laasch T., Laasch E.: Haustechnik Grundlagen – Planung – Ausführung, 13 Auflage, Springer Verlag, 2013
  • Haus der Zukunft:
  • Stadt der Zukunft:
  • Forschung für die energieeffiziente Stadt:


  • Präsentation
  • Projektarbeit
  • Mitarbeit
Modul 22 IKT (AMOD)
German / kMod
Datenanalyse (DATA)
German / ILV, FL


Datenanalyse als Grundlage zur Unternehmenssteuerung.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Informationen im Unternehmen geeignet zu erfassen und entsprechend zu klassifizieren
  • Statistische Auswertungen durchzuführen und die Ergebnisse korrekt zu interpretieren
  • Datenanalyse als wesentlichen Input für die Entwicklung von technischen Konzepten zu verwenden
  • die Datenauswertung im Softwarelebenszyklus zu implementieren
  • die Grundlagen eines Data-Warehouse-Systems zu erklären


  • Software life cycle
  • Dokumentation, Klassifikation von Information
  • Informationserfassung
  • Datenanalyse, Statistik
  • Einführung Data Warehousing
  • Data Warehouse Architektur
  • Data Warehouse Design
  • ETL Prozess


Kenntnisse und Erfahrung im Bereich Softwaretechnik bzw. Kenntnisse in SQL und RDBMS


  • Studienbriefe
  • M. Nusselein (2003): Inhaltliche Gestaltung eines Data Warehouse-Systems am Beispiel einer Hochschule, Bayerisches Staatsinstitut für Hochschulforschung und Hochschulplanung
  • M. Oestreich, O. Romberg (2009): Keine Panik vor Statistik! - Erfolg und Spaß im Horrorfach nichttechnischer Studiengänge, Vieweg+Teubner | GWV Fachverlage GmbH, Wiesbaden (Bezug: SpringerLink)
  • J. Bortz (2004): Statistik, Springer Medizinverlag Heidelberg, 6. Auflage


  • Übungen
  • Test
Smart Data (SMD)
German / ILV, FL


In der Lehrveranstaltung lernen die Studierenden Grundlagen der verteilten urbanen Datenquellen, Smart Cities Lösungen unter Einbindung unterschiedlicher Datenquellen, die Funktionsweise von Verschlüsselung und Signatur von Informationen sowie deren Anwendung.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Das Konzept der Signaturen und Verschlüsselung erklären
  • Smart City Lösungen unter Einbindung unterschiedliche Datenquellen konzipieren
  • Informationen geeignet zu erfassen und entsprechend zu klassifizieren


  • Security Und Privacy
  • Digitale Signaturen
  • Verschlüsselung
  • Verteilte urbane Datenquellen im Bereich Verkehr und Energie (Sensoren, Aktuatoren, Electronic Tolling, DSRC, Smart Grids, Smart Buildings etc.)
  • Internet of Things (IOT) System-Architektur
  • Open Data
  • Datennutzung


  • Eckert, C. (2006): IT-Sicherheit. Konzepte - Verfahren – Protokolle, Oldenbourg
  • Andelfinger, V.P. / Hänisch, T. (2014); Internet der Dinge: Technik, Trends und Geschäftsmodelle, Springer Gabler
  • Kopetz, Hermann (2011): Internet of things: Real-time systems. Springer
  • Weber, R. H. / Weber, R. (2010): Internet of Things. Springer


  • LV-immanente Leistungsbeurteilung und Abschlussprüfung
Modul 23 Wahlmodul 2 (WMOD2)
German / kMod
Modul 23a AK2 - Urbane Logistik (AK23a)
German / kMod
Technische Logistik und Flottenmanagement (AK2TLOG)
German / ILV, FL


Der Kurs "Technische Logistik und Flottenmanagement" gibt einen Kurzüberblick über die wichtigsten Transportlogistik-Abläufe und dem Nutzerpotential von Informations- und Kommunikations-Technologien (IKT) und Intelligenten Verkehrssystemen (IVS).


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung.


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Die wichtigsten Grundbegriffe im Umfeld der Transportlogistik im internationalen Praxisumfeld entsprechend einzusetzen
  • basierend auf vorhanden technologischen Anwendungen in der Transportentwicklung diese weiterzuentwickeln, d.h. insb. Anforderungsanalysen zu erarbeiten und technische Umsetzungskonzepte zu konstruieren
  • Verkehrsinformationen und –anwendungen für konkrete Transportlogistik-Prozesse abzuleiten und potentielle Integrationsmöglichkeiten dieser in technologische Anwendungen zu planen


  • Logistik und Logistikmanagement (Grundbegriffe und Definitionen)
  • IT in der Logistik (RFID, eFreight)
  • Transportplanung (Verkehrsinformationen, Software-Anwendungen)
  • Transportdurchführung (Sendungsverfolgung, rechtliche Aspekte)
  • Transportsicherheit (inkl. Technologien)
  • Flottenmanagement (Sensoren, digitaler Tachograph)


Verkehrssysteme, IKT, Management.


  • Klatt, Gerhard (2017): Technische Logistik und Flottenmanagement, Wien, (Skript)


  • LV-immanente Leistungsbeurteilung (Kursarbeit) und Abschlussprüfung


Gast-Vorträge während Kurs.

Urbane Logistik (AK2ULOG)
German / ILV, FL


Im Zuge dieser Lehrveranstaltung wird das Thema der urbanen Logistik näher beleuchtet. Hierbei liegt der Fokus auf dem "Was?", "Warum?", "Wie?": "Was wird transportiert?", "Warum wird es transportiert?", und "Wie wird es transportiert?" Anhand von (teilweise internationalen) Beispielen wird die Thematik genauer beleuchtet, sodass letztlich die Teilnehmer und Teilnehmerinnen dieser Lehrveranstaltung selbst befähigt sind, urbane Logistikaufgabenstellungen mit zukunftsweisenden Methoden zu lösen.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Aufgabenstellungen der urbanen Logistik zu erkennen
  • Aufgabenstellungen der urbanen Logistik zu lösen
  • Lösungemethoden in der urbanen Logistik zu bewerten


  • Logistik-Trends und spezieller Handlungsbedarf in Städten
  • Entwicklungen und Herausforderungen
  • Akteure und deren Erwartungen
  • Klassische Ansätze zur Sammlung und Verteilung von Waren in Städten (Verkehrsträger, Verkehrsmittel, Ladungsträger, Touren- und Routenplanung, etc)
  • Innovative Ansätze zur Bündelung, Optimierung und Ressourcenschonung
  • City-Logistics-Projekte (Case Studies)


keine speziellen - Lehrinhalte der LV "Technische Logistik und Flottenmanagement"


  • Gonzalez-Feliu / Semet / Routhier (2014): Sustainable Urban Logistics: Concepts, Methods and Information Systems, Springer
  • Schrampf, J. / Zvokelj, A. / Hartmann, G.(2013): Smart Urban Logistics. Effizienter Güterverkehr in Ballungszentren Strategisches Gesamtkonzept


  • LV-immanente Leistungsbeurteilung (Kursarbeit) und Abschlussarbeit (in Heimarbeit)
Modul 23b AK2 - Elektromobilität (AK23b)
German / iMod
Aktuelle Themen der Elektromobilität (AK2ELMOB)
German / ILV, FL


Basierend auf einer Einführung in die Elektromobilität (Gesetzgebung, Fahrzeuge, Energiebedarf, Energiespeicher, Ladetechnik, Business Modelle) werden die aktuellen Trends und Entwicklungen in Form von Case Studies von den Studierenden erarbeitet/bewertet und diskutiert. Ebenso werden bestehende und mögliche Business Modelle für verschiedenen Bereiche der Elektromobilität (Car-sharing etc.) vorgestellt.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Aktuelle Trends der Elektromobilität, hinsichtlich der technischen und wirtschaftlichen Faktoren zu bewerten
  • Technische und nicht technische Faktoren für den erfolgreichen Einsatz von Elektromobilität zu benennen
  • Business Modelle für Elektromobilität zu bewerten
  • Erfolgsfaktoren anhand internationaler Elektromobilitätsbeispielen (Case Studies) aufzuzählen
  • Derzeitige Gesetzgebung für Elektromobilität zu beurteilen
  • Trends bei Energiespeichern (Kosten, Technologie, Akteure) zu spezifizieren
  • Existierende State-of-The-Art Ladetechniken zu evaluieren
  • Existierende Fahrzeugtypen je nach Elektrifizierungsgrad systematisch zu beschreiben


  • Entwicklungen und Herausforderungen bei der Einführung von Elektromobilität (Gesetzgebung, Fahrzeuge, Reichweite, Ladeinfrastruktur, Energiespeicher)
  • Urbane Anwendungsfälle der Elektromobilität
  • Akteure und deren Erwartungen
  • Businessmodelle der Elektromobilität
  • Case Studies der Elektromobilität


  • Cocca, S. / Fabry, C. / Styrja, C. (2015): Dienstleistungen für Elektromobilität, Fraunhofer
  • Karle, A. (2015): Elektromobilität: Grundlagen und Praxis, Hanser
  • Wallentowitz, Henning / Freialdenhoven, Arndt (2011): Strategien zur Elektrifizierung des Antriebsstranges, Springer
  • Proceedings aktueller Konferenzen (etwa: e-motion, urban-city, …)


  • Case Studies und Abschlussprüfung
Modul 23c AK2 - Sensorik und Regelungstechnik (AK23c)
German / kMod
Regelungstechnik (AK2REG)
German / ILV, FL


Es werden die Grundlagen der Regelungstechnik vermittelt und im Zuge einer Laboreinheit auch praktisch angewandt


Vorlesung und Labor


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Nach erfolgreichen Abschluss der LV sind die Studierenden in der Lage:• Ein einfaches Regelungstechniksystem im Labor zu identifizieren, zu regeln und zu optimieren
  • Nach erfolgreichen Abschluss der LV sind die Studierenden in der Lage:
  • Ein einfaches Regelungstechniksystem im Labor zu identifizieren, zu regeln und zu optimieren


  • Grundlagen RegelungstechnikStrecken, Regler, Stabilität, Fuzzy Logik, Genetische Algorithmen




  • Einführung Regelungstechnik, Busch


  • Schriftliche Prüfung und Laborbericht
Sensorik (AK2SEN)
German / ILV, FL


Kurze Einführung in die Grundprinzipien der Sensorik - Prinzip des Transducers und dessen CharakteristikMessfehler und lineare RegressionDiskussion physikalischer Signale, deren deterministischer und statistischer CharakterPrinzip der Signalausbreitung auf LeitungenAnwendung elektronischer Bauelemente als sensorisches Element zur Erfassung physikalischer Größen und Darstellung derer als elektrische Größe


Klassische Vorlesung mit Beispielen und Übungen zur Illustration des Funktionsprinzips und Vertiefung des Stoffgebiets.


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Verständnis für das Wesen der Sensorik, die verwendeten Methoden und Prinzipien der Umwandlung einer physikalischen Größe in ihre elektrische RepräsentationVerständnis des Signalbegriffes und der Behandlung des deterministischen als auch statistischen Wesens von physikalischen SignalenBerechnung von Signalkennwerten. Verwendung idealer/nicht idealer elektronischer Bauelemente als sensorischer WandlerPrinzipien und Möglichkeiten der Erfassung physikalischer GrößenPhysikalische Wandlerprinzipien und deren Anwendung in der Sensorik mit verkehrstelematischem Schwerpunkt


  • Kurze Einführung in das Gebiet und Wesen der SensorikVorstellung der SI Einheiten als Basisbezugssystem für MessungenCharakterisierung von Sensoren als mehrfache Wandler und deren KennlinieMethoden der linearen Approximation des Kennlinienverlauf und lineare Regression. Charakterisierung von stochastischen und deterministischen SignaleWahrscheinlichkeitsdichtefunktion und Spektrum verschiedener RauschartenBerechnung von SignalkennwertenPrinzip der Wellenausbreitung auf Übertragungsleitungen, Telegraphengleichung, Reflexion und WellenwiderstandPhysikalische Grundlagen der Stromleitung in FestkörpernElektrische Widerstände und deren Anwendungen als sensorisches ElementThermisch veränderliche Widerstände, Thermistoren, magnetoresisitive SensorenPiezoresistive SensorenElektrisches Feld, Begriff des elektrischen Potentials, kapazitive Bauelemente und deren Anwendung als SensorFeuchtemessung und Grundlagen der MEMSBeschleunigungssensoren, Gyroskope und TrägheitsnavigationssystemeMagnetisches Feld und induktive Sensoren, Grundlagen der Akustik und akustische Sensoren


Keine fachspezifischen Voraussetzungen notwendigElektronische und physikalische Vorkenntnisse auf BSc. Niveau aber von Vorteil


  • Jacob Fraden, Handbook of modern sensorsIan Sinclair, Sensors and TransducersIan Sinclair, Passive componentsOwen Bishop, electronics - Circuits and systems


  • Schriftliche Prüfung und Projekt am Ende des Semesters.
Modul 23d AK2 - Verteilte und Zuverlässige Systeme (AK23d)
German / iMod
Verteilte und Zuverlässige Systeme (AK2VSYS)
German / ILV, FL
Modul 23e AK2 - Urbane Beleuchtung (AK23e)
German / iMod
Lichttechnologien für urbane Beleuchtung (AK2LICHT)
German / ILV, FL


In dieser Vorlesung werde urbane Beleuchtungen behandelt.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung, Übungen im Labor


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Relevante physikalische Eigenschaften von Leuchtmitteln aufzählen und deren Bedeutung erläutern zu können.
  • technisch relevante Leuchtmittel, deren Vor- Nachteile und Anwendungsgebiete aufzählen zu können.
  • Verfahren zur Regelung und Ansteuerung von Leuchtmitteln aufzählen und erklären zu können.
  • Planungsgrundlagen zu Innenraum und Freiraum-Lichtsystemen aufzählen und anwenden zu können.
  • optische Parameter der Lichtplanung aufzählen zu können wie Raumwinkel, Lichtstrom, Lichtausbeute, Beleuchtungsstärke, Tageslichtquotient, Leuchtdichte, Farbtemperatur, optischer Wirkungsgrad
  • wahrnehmungspsychologische Aspekte von Beleuchtung zu erläutern und relevante Begrifflichkeiten, wie Akkommodation, Adaption Sehschwellen, Gesichtsfeldparameter, Wahrnehmungsmodelle, aufzuzählen sowie deren Bedeutung zu erklären.
  • relevante physikalische und wahrnehmungspsychologische Aspekte von Farbe zu erklären.


  • Lichttechnische Grundlagen
  • Licht und Wahrnehmung
  • Überblick über Leuchtmittel
  • Ansteuerung und Regelung von Leuchtmitteln
  • Konzeption von Lichtsystemen (technisch und wirtschaftlich)
  • Innenraum-, Freiraumanlagen, Sicherheitsbeleuchtung, Notbeleuchtung


  • Hering, E. / Martin, R. (2006): Photonik: Grundlagen, Technologie und Anwendung, Springer Verlag
  • Ris, H. R. (2015): Beleuchtungstechnik für Praktiker: Grundlagen, Lampen, Leuchten, Planung, Messung, VDE Verlag
  • Witting, W. (2014) Licht. Sehen. Gestalten. Lichttechnische und wahrnehmungs-psychologische Grundlagen, Birkhäuser Verlag
  • Versuchsanleitungen


  • Abschlussprüfung und Benotung der Laborprotokolle
Modul 23f AK2 - Bildverarbeitung (AK23f)
German / iMod
Anwendungsorientierte Bildverarbeitungstechnologien (AK2BILD)
German / ILV, FL
Modul 24 Projekt 2 (PRJ2)
German / iMod
Projektarbeit 2 (PRJ2)
German / PRJ


Umsetzung des im 1. Semester analysierten Projekts




Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • funktionale Anforderungen in eine detaillierte Umsetzungsplanung überführen
  • Zeit- und Ressourcen abzuschätzen und zu planen
  • Anforderungen gemäß Planung zu implementieren
  • Resultate in Form eines wissenschaftlichen Papers darzustellen


  • Umsetzung von Projekten in (interdisziplinärer) Teamarbeit
  • Führen eines Projekthandbuchs
  • Detailspezifikation
  • Zeit und Ressourcenplanung
  • planungsgemäße Umsetzung eine Projektimplementierung


Projektarbeit 1, technische Vorkenntnisse je nach Projektthema


  • Abhängig vom Projektthema


  • LV-Immanent, Projektergebnis, Documentation, Präsentationen, Paper
Modul 25 Unternehmenskooperation (UKO)
German / kMod
Internationale Smart City Dimensionen (ISCD)
German / ILV, FL


Die Lehrveranstaltung behandelt die Einbettung einer Stadt/Region in supranationale Angelegenheiten, wie insbesondere die Europäische Gesetzgebung, Empfehlungen und Rahmenbedingungen, die Aktivitäten und Handlungsspielraum der Europäischen Kommission im Angesicht der Subsidiarität, die Rolle von Dachverbänden wie UITP, Eurocities, Polis, Konvent der Bürgermeister und zuletzt den Einblick in wichtige EU-Projekte.


Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Einbettung lokaler Aktivitäten in supranationale Rahmenbedingungen zu beurteilen
  • Einflussfaktoren nationaler und internationaler Instanzen zu erkennen und zu beurteilen sowie Chancen für die lokale Entwicklung abzuleiten
  • die Rolle der Standardisierung einschätzen zu können
  • Aktivitäten der lokalen Politik zu bewerten


  • Hierarchische Gliederung Region - Staat – supranationale Organisationen
  • Europäische Gesetzgebung, Empfehlungen und Rahmenbedingungen
  • Aktivitäten und Handlungsspielraum der Europäischen Kommission im Angesicht der Subsidiarität
  • Rolle von Dachverbänden UITP, Eurocities, Polis, Konvent der Bürgermeister
  • Wichtige EU-Projekte: Aktivitäten und Erkenntnisse
  • Rahmenbedingungen außerhalb Europas


Absolvierte LVA "Stadtprozesse" (SPZ) empfohlen


  • CEN TC278 WG3 (ITS Public transport) & review of some research projects paving the way
  • CEN TC278 Approach for Gap Analysis Urban ITS
  • Europäische Kommission (2013):: IVS-Expertengruppe für Urbane Bereiche, „Guidlines for ITS deployment in Urban Areas“
  • Europäische Kommission (2013): „Best Practices in Urban ITS -Collection of Projects”
  • Europäische Kommission (2013): Together towards competitive and resource-efficient urban mobility, COM 913 final
  • Europäische Kommission (2013): Mobilising Intelligent Transport Systems for EU cities, SWD(2013) 527 final
  • Europäische Kommission (2011): Weissbuch - Fahrplan zu einem einheitlichen europäischen Verkehrsraum – Hin zu einem wettbewerbsorientierten und ressourcenschonenden Verkehrssystem: KOM(2011) 144 endgültig
  • Europäische Kommission (2009): Aktionsplan urbane Mobilität: KOM(2009) 490
  • ISIS, CIVITAS in Europe, A proven framework for progress in urban mobility, 2007
  • KU Leuven, UITP, Study on Harmonised Collection of European Data and Statistics in the Field of Urban TraCnsport and Mobility, 2013
  • UN-Habitat (2013): Promoting Non-Motorized Transport in Asian Cities: Policymakers’ Toolbox
  • UN-Habitat, Indicators of urban, poor communities and their accessibility


  • LV-immanente Leistungsbeurteilung
Organisationsentwicklung und Change Management (OECM)
German / ILV, FL


In dieser Lehrveranstaltung werden die drei Schwerpunkte Reallaboratorien, Transformative Wissenschaft und Methoden der Transdisziplinarität behandelt. Mittels Rollensimulationen werden Beratungsgespräche mit unterschiedlichen städtischen Stakeholdern mittels Lektorentandem geübt. Erstellt wird eine schriftliche Konzeption für ein Reallabor.


Inhaltliche Vermittlung und Lehrgespräch Exkursion Beratungssimulationen Poster Präsentationen Abschlussarbeit Fernlehrunterstützung per Moodle


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Anforderungen von Reallaboratorien zu benennen und diese exemplarisch in ein Konzept für ein Reallabor umzusetzen;
  • die Gütekriterien der auf Veränderung abzielenden Transformativen Wissenschaft plausibel darzulegen;
  • Methoden der Transdisziplinarität exemplarisch im Konzept für ein Reallabor vorzusehen und anderen InteressentInnen nachvollziehbar erklären zu können;
  • Beratungsgespräche mit unterschiedlichen urbanen Stakeholdern mittels systemischer Fragetypen wissensgenerierend führen zu können.


  • Modelle urbaner Reallaboratorien
  • Transformative Wissenschaft als Begleitung transdisziplinärer Veränderungsprozesse
  • Systemische Fragetypen im Beratungsgespräch mit urbanen Stakeholdern
  • Konzeption eines Reallabors unter Einbindung transdisziplinärer Methoden


Anforderungen an Smart-City Konzepte


  • Bergmann, M., Jahn, T., Knobloch, T., Krohn, W., Pohl, C., and Schramm, E., Methoden transdisziplinärer Forschung: Ein Überblick mit Anwendungsbeispielen, 1st ed. Campus Verlag, 2010. (Auszüge)
  • Rückert-John, J., ed., Soziale Innovation und Nachhaltigkeit. Innovation und Gesellschaft. Wiesbaden: Springer Fachmedien Wiesbaden, 2013. (Auszüge)
  • Schneidewind, U., ed., Transformative Wissenschaft: Klimawandel im deutschen Wissenschafts- und Hochschulsystem, 2nd ed. Metropolis, 2014. (Auszüge)
  • Schneidewind, U., Bürgeruniversität spiegelt den Dialogwunsch: Konzept der "Bürgerhochschule"; ein Katalysator für eine starke Bürgerwissenschaft. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2015. (moodle)
  • Uwe Schneidewind, Carsten v. Wissel, “Transformative Wissenschaft,” (accessed March 14, 2017). (moodle)
  • Schneidewind, U., Urbane Reallabore: Ein Blick in die aktuelle Forschungswerkstatt. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2014. (moodle)
  • Schneidewind, U. and Singer-Brodowski, M., Transformative Forschung als Motor für die Gestaltung von Systemübergängen: Auf dem Weg zu einem neuen Innovationsverständnis. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2013. (moodle)
  • Schneidewind, U., Pfriem, R., Barth, J., Beschorner, T., Binswanger, M., Diefenbacher, H., Eisenack, K. et al., Transformative Wirtschaftswissenschaft im Kontext nachhaltiger Entwicklung: Für einen neuen Vertrag zwischen Wirtschaftswissenschaft und Gesellschaft. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2016. (moodle)
  • Schneidewind, U., Transformative Wissenschaft: Motor für gute Wissenschaft und lebendige Demokratie. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2015. (moodle)
  • Schneidewind, U. and Singer-Brodowski, M., Vom experimentellen Lernen zum transformativen Experimentieren: Reallabore als Katalysator für eine lernende Gesellschaft auf dem Weg zu einer Nachhaltigen Entwicklung. Wuppertal: Wuppertal Institut für Klima, Umwelt, Energie, 2015. (moodle)


  • LV-immanente Leistungsbeurteilung

3. Semester

Bezeichnung ECTS
Modul 31 Stadtplanung (SPL)
German / kMod
Integrative Stadtplanung (ISPL)
German / ILV, FL
Kritische Infrastrukturen (KINF)
German / ILV, FL
Modul 32 Simulation (SIM)
German / kMod
German / ILV, FL


Der Kurs vermittelt den Studierenden einen weiteren Blick auf geographische Informationssysteme. Zu Beginn werden Grundlagen wie Koordinatensysteme und die Unterschiede zwischen Raster- und Vektor-Daten behandelt. Speichermechanismen, wichtige Algorithmen und deren Anwendung werden gezeigt. Im weiteren Verlauf werden werden komplexere Probleme wie beispielsweise Datenqualität diskutiert. Den Abschluss bilden eine rechtliche und wirtschaftliche Betrachtung geographischer Informationen.


Frontalvorlesung mit 2 begleitenden Hausaufgaben und einem selbstgewählten Projekt anhand dem die in der Vorlesung angesprochenen Punkte durchgedacht werden sollen.


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Die Studierenden erwerben Basiswissen bezüglich der Probleme, die beim Entwurf eines Geoinformationsproduktes auftreten: Welche Daten sind in welcher Qualität notwendig, woher bekommt man diese Daten, gibt es rechtliche Problembereiche, usw. Am Ende sind die Studierenden in der Lage ein Geoinformationsprodukt zu entwickeln, zu präsentieren und (eventuell mit der Unterstützung von Programmierern) umzusetzen.


  • Koordinatensysteme und -Rahmen (lokal und global)Arten von GIS: Raster- und Vektor-GISDarstellung von Raster- und Vektor-Daten im ComputerGIS-Operationen für Raster- und Vektor-DatensätzeDatenqualitätEntwurf von Geoinformationsprodukten: Kosten-Nutzen-AnalyseRechtliche Rahmenbedingungen von GeodatenTypische Datensätze und woher man sie bekommt


Grundlagen der MathematikKreativität


  • Cho, G., Geographic Information Science: Mastering the Legal Issues. 2005: John Wiley & Sons, Ltd.Tomlinson, R. , Thinking about GIS. 2007: ESRI PressWorboys, M.F., GIS: A Computing Perspective. 1995, London: Taylor & Francis


  • Mündliche PrüfungHausaufgaben (am Computer)Präsentation des Projektes samt schriftlicher Ausarbeitung
Simulation (SIM)
German / ILV, FL
Modul 33 Wahlmodul 3 (WMOD3)
German / kMod
Modul 33a AK3 - IT Sicherheit in Energie und Mobilität (AK33a)
German / iMod
IT Sicherheit in Energie und Mobilität (AK3ITSEC)
German / ILV, FL
Modul 33b AK3 - Smart Healthcare (AK33b)
German / kMod
Crowd Sourced Healthcare in Smart Cities (AK3HEALTH)
German / ILV, FL


Die Lehrveranstalung beschäftigt sich mit technischen Systemen, Prozessen und Standards zur crowd basierten Datenaufnahme, Transfer und Integration in Gesundheitsakten. Ebenso wird Einsicht in aktuelle und zukünftige interoperables Dokumentenformate zur Datenspeicherung gegeben.


Vorträge, Diskussionen und Gruppenarbeiten zu den verschiedenen Themen, selbstständiges Erarbeiten von zur Verfügung gestellten Themenbereichen


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • aktuelle Konzepte zur crowd basierten Datenaufnahme im med. Kontext wiederzugeben
  • standards und Prozesse zur Systemintegration von personalisierten med. Daten zu erklären und zu beschreiben
  • technische grundlagen interoperabler medizinischer Dokumente zu beschreiben und wiederzugeben


  • Crowed Sourced Health Intro, X73 Standard
  • Medical Device Connectivity from international standards perspective
  • FHIR – Fast Healthcare Interoperability Resources
  • CDA - Clinical Document Architecture


- Einfache Programmierkenntnisse - Grundlegend technisches Verständnis und Interesse - Erste Kenntnisse des Medizinwesens von Vorteil


  • Unterlagen im CIS
  • Moodle Links


  • Praktische Übungen und Aufgaben
Integration und Nutzung vernetzter medizinischer IT Infrastrukturen (AK3MED)
German / ILV, FL


Die LVA legt ein besonderes Augenmerk auf die IHE Technical Frameworks (Verwendung in ELGA) zum standardisierten, interoperablen und zukunftssicheren austausch von Daten mittels medizinischen Informationssystemen auf nationaler und internationaler Ebene.


Vorträge, Diskussionen und Gruppenarbeiten zu den verschiedenen Themen, selbstständiges Erarbeiten von zur Verfügung gestellten Themenbereichen


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Basis Terminologien von IHE zu verwenden
  • den IHE Connectathon und die Abläufe zu erklären und die Anforderungen zu beschreiben
  • die Unterschiede zwischen den Profilen XDR, XDM und XDS sowie deren Querverbindungen zu beschreiben
  • die IHE Cross-Community Profile XCA und XCPD zu beschreiben
  • das Identity Management (basierend auf PIX, PDQ) in IHE zu beschreiben
  • die Grundlagen der IT-Security basierend auf IHE Security Profilen (CT, ATNA, XUA, BPPC) zu erklären
  • die ELGA Architektur und Sicherheitsanforderungen von ELGA zu beschreiben


  • Terminologien der IT-Standardisierung
  • Grundverständnis von IHE und Interoperabilität
  • Document Exchange Profile anhand der elektronischen Gesundheitsakte ELGA
  • IT-Security Profile am Beispiel der elektronischen Gesundheitsakte


- Einfache Programmierkenntnisse - Erste Kenntnisse des Medizinwesens


  • Unterrichtsmaterialien im CIS
  • Moodle Links


  • Gruppenübungen
  • Abschlussprüfung
Modul 33c AK3 - Big Data (AK33c)
German / kMod
Semantische Wissensrepräsentation und Linked Data (AK3SEM)
German / ILV, FL
Technische Konzepte Big Data (AK3TBD)
German / ILV, FL
Modul 33d AK3 - Autonomes Fahren (AK33d)
German / iMod
Autonomes Fahren (AK3AUTF)
German / ILV, FL
Modul 33e AK3 - Kooperative Systeme (AK33e)
German / iMod
Kooperative und vernetzte Systeme (AK3KOPS)
German / ILV, FL


Introduction into the field of vehicle-vehicle-interaction and infrastructure-vehicle interaction. The course is organized around core technologies like wireless communication or human machine interaction and reference projects.




Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • The student is familiar with vehicle-infrastructure-interaction, it's applications and technologiesKnowledge about inter-relations of applicationsKnowledge about proven technologies and existing challenges


  • Systems view of VIICommunication TechnologyHuman FactorsxFCDImportant projects (Coopers, etc.)Trends in Traffic ManagementRole of infrastructural data


ITS technologies (HMI, wireless communication technology).


  • Conference proceedings on ITS world congressIEEE


  • Written examination
Modul 34 Spezialisierung (WMOD3)
German / kMod
Spezialisierung (SPEZ)
German / SE
Wissenschaftliches Arbeiten (WIA)
German / SE
Modul 35 Wirtschaft (WMOD3)
German / kMod
Ausschreibungen und Innovationsmanagement (INNO)
German / ILV, FL
Smart City Geschäftsmodelle (SCGM)
German / ILV, FL

4. Semester

Bezeichnung ECTS
Modul 41 Mastermodul (MSC)
German / kMod
Diplomandenseminar (DIPL)
German / SE


Seminar untergliedert sich in 2 Teile: 1. Teil: (a) Präsentation und (b) Verteidigung der Master Thesis durch die Studierenden auf der Grundlage der LV "Graduate Seminar"2. Teil: Schriftliche Erstellung eines Basiskonzepts durch die Studierenden auf der Grundlage der Master Thesis


1) Präsentationen der Studierenden2) Hearing-Situationen mittels Fragen aus dem Publikum von Studierenden und Lektorenstaff im Anschluss an die Präsentation3) unmittelbare Darlegung der eigenen Lessons Learned durch die Präsentierenden mit Hilfe der Lektorenfeedbacks4) Erstellung eines schriftlichen Basiskonzepts


Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • 1) eigene Forschungsresultate in Verbindung mit theoretisch begründeten Forschungsfragen und methodischen Herangehensweisen plausibel und übersichtlich visualisiert dem Zielpublikum präsentieren können2) auf vorbereitete und auch spontan gestellte Fragen aus dem Publikum (Lektorenstaff, Studierende) nachvollziehbar und engagiert eingehen können3) Basiskonzept der Master Thesis sprachlich und grammatikalisch prägnant in eine schriftliche Ausarbeitung umsetzen können4) verwendete Literaturquellen aus allen benützten Medien nach den Empfehlungen des Leitfadens Version 2012 zitieren können


  • 1) Präsentation der eigenen Master Thesis2) Verteidigung der Master Thesis in einer Hearingsituation 3) schriftliche Formulierung des Basiskonzepts nach den Gliederungskriterien des Leitfadens zum wissenschaftlichen Arbeiten V2012


1) Graduate Seminar2) inhaltliche Schwerpunkte der Master Thesis3) Präsentationstechnik


  • CIS platform: see slides 1-3Hrdina, C. and Hrdina, R., Langenscheidt Scientific English für Mediziner und Naturwissenschaftler: Formulierungshilfen für wissenschaftliche Arbeiten, Publikationen und Vorträge; [neu jetzt mehr als 1400 Beispielsätze], 2nd ed. Berlin ; Wien u.a: Langenscheidt, 2009.Skern, T., Writing scientific english: A workbook. Schlüsselkompetenzen 3112. Wien: facultas.wuv, 2009


  • 1) Beurteilung der Präsentation inklusive der Hearingsituation durch den Lektorenstaff2) Beurteilung des schriftlichen Basiskonzepts durch den Lektorenstaff


Teamteaching; Beurteilung der Outcomes durch 2 Lektoren

Master Thesis (MT)
German / BE
Scientific Writing (SCW)
English / SE