Integrative Stadtentwicklung - Smart City: Lehrveranstaltungen und Informationen zum Studium

Fakten zum Studium

  • Start: Oktober
  • Kosten pro Semester: € 363,36 Studiengebbühr, € 75,- Kostenbeitrag für Zusatzleistungen, € 19,20 ÖH-Beitrag
  • Präsenzphasen: Dienstags, Mittwochs, Donnerstags jeweils 17:50 - 21:00 plus Fernlehrunterstützung
  • 120 ECTS-Punkte
  • Möglichkeit für ein Auslandssemester

Lehrveranstaltungen

Hier finden Sie die aktuellen Lehrveranstaltungen des Studiengangs. Die Darstellung unterliegt laufenden Aktualisierungen und entspricht nicht zwangsläufig dem Studienplan für das nächste Studienjahr. Module, die sich über mehrere Semester erstrecken, werden jeweils mit der ECTS-Zahl für alle Semester angezeigt. Legende: 

  • kMod kumulatives Modul (jede LV besitzt eine eigene Prüfung)
  • iMod integratives Modul mit abschließender Modulprüfung
  • UE Übung
  • ILV Integrative Lehrveranstaltung
  • SE Seminar
  • LAB Laborstunden
  • TUT Tutorien 

1. Semester

Bezeichnung ECTS
SWS
Modul 11 Ausgleichsmodul (AMOD)
German / kMod
6.00
-
Grundlagen der urbanen Energieversorgung (GUE)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Grundlagen der urbanen Energieversorgung spannen einen Bogen von den Grundbegiffen der Energielehre/des Energiesystems, über den Status des bestehenden städtischen Energiesystems bis hin zu den aktuellen Herausforderungen der urbanen Energieversorgung und der Gebäudetechnik.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die bauphysikalischen Grundlagen des energieeffizienten Bauens und die gebäudetechnischen Grundlagen in einfachen Beispielen anzuwenden
  • aufbauend auf den Grundbegriffen der Energielehre den aktuellen Status des städtischen Energiesystems zu beschreiben und evaluieren
  • die zukünftigen Herausforderungen des städtischen Energiesystems zu benennen und Lösungsansätze zu skizzieren

Lehrinhalte

  • Grundlagen der konventionellen und erneuerbaren Energietechnologien
  • Energieversorgungskonzepte und Strukturen mit Fokus urbaner Raum
  • Bauphysikalische Grundlagen, Grundlagen der Energieversorgung im Gebäude
  • Grobe Anlagendimensionierung Erneuerbare Energietechnologien, Ener0giebedarfsberechnungen von Gebäuden, Energetische Bewertung von Energietechnologien und Gebäuden

Vorkenntnisse

Naturwissenschaftlich-technisch-physikalisches Grundlagenwissen

Literatur

  • Quaschning / Voljer (2015), Regenerative Energiesysteme, Hanser
  • Recknagel / Sprenger / Alber (2015), Taschenbuch für Heizung + Klimatechnik 2015/2016, DIV
  • Riccabona, Christof / Bednar, Thomas (2010): Bauphysik; Manz

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Grundlagen des Verkehrswesens (GVW)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung dient der Einführung in die Themen Mobilität und Verkehr. Die wichtigsten Grundlagen im Bereich der Verkehrsplanung werden mittels Vorlesungen und Übungen vermittelt. Die Lehrveranstaltung wird mit einer schriftlichen Prüfung abgeschlossen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Zusammenhänge von Kenngrößen des Verkehrsablaufs zu beschreiben
  • Verkehrsplanerische Begrifflichkeiten, Dokumente, Analysen zu verstehen und zu hinterfragen
  • gängige Erhebungsmethoden im Verkehrswesen (z.B. Zählungen, Befragungen) sowie deren Anwendungsfelder zu beschreiben
  • gängige Darstellungsformen von Mobilitäts-/Verkehrsdaten zu beschreiben und die Daten zu interpretieren.
  • Grundsätze für die Gestaltung von ÖPNV-Systemen zu erläutern (Basiswissen)
  • den Planungsablauf zu beschreiben und Instrumente zur Beurteilung von Maßnahmen anzuwenden (Basiswissen)
  • Umweltauswirkungen von Verkehr benennen (Basiswissen)
  • Elemente der Querschnittsgestaltung von Straßen zu beschreiben

Lehrinhalte

  • Verkehrsplanung: Grundlagen und Begriffe
  • Verkehrsangebot, Einführung ÖPNV, Verkehrsnachfrage
  • Planungsablauf, Entscheidungshilfen
  • Verkehrserhebungen
  • Verkehrssicherheit
  • Überblick Umweltwirkungen
  • Einführung in die Straßenplanung: Verkehrsablauf auf der freien Strecke, Querschnittsgestaltung von Straßen

Vorkenntnisse

keine

Literatur

  • Höfler, Frank (2006), Verkehrswesen-Praxis, Band 1: Verkehrsplanung, Beuth
  • Höfler, Frank (2006), Verkehrswesen-Praxis, Band 2:: Verkehrstechnik Beuth
  • Winfried, Reinhardt (2012): Öffentlicher Personennahverkehr – Technik – rechtliche und betriebswirtschaftliche Grundlagen, Vieweg+Teubner Verlag-Springer Fachmedien, Wiesbaden GmbH
  • Schnabel, W.; Lohse, D. (2011) Straßenverkehrstechnik, Band 1 und 2
  • Jeweils angegebene Regelwerke (RVS etc.)

Anmerkungen

Moodlekurs beachten

IT Netze und Datenmanagement (ITN)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

In der Lehrveranstaltung lernen die Studierenden die Grundlagen der Netzwerktechnik (kabelgebunden, kabellos) sowie die Grundlagen von relationalen Datenbanken.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • ER Diagramme zu erklären
  • eine Relationale Datenbank mittels SQL zu befüllen, zu verändern und abzufragen
  • die wichtigsten Protokolle das OSI Layer Model inkl. Vor- und Nachteile, zu benennen
  • IPv4- und IPv6-Adressen zu kategorisieren

Lehrinhalte

  • Grundlagen Netzwerktechnik
  • ISO/OSI Modell und Protokolle
  • IP Adressen (IPv4 und IPv6)
  • Domain Name System
  • Definition und Spezifikation relationaler Datenbanken
  • Entwurf semantischer und physikalischer Datenmodelle
  • Datenmodellierung mit ER-Diagrammen
  • Basics in SQL (DDL, DML, DCL)

Vorkenntnisse

keine

Literatur

  • Tanenbaum, Andrew S. / Hübner, C. (2012), Computernetzwerke: Pearson Studium; Auflage: 5., aktualisierte Auflage
  • Elmasri, R.A. / Navathe, S.B. / Shafir, A. (2011): Grundlagen von Datenbanksystemen, Bachelorausg., 3., aktualisierte Aufl., ed, IT - Informatik. Pearson Studium, München
  • Faeskorn-Woyke, H. (Ed.) (2007): Datenbanksysteme: Theorie und Praxis mit SQL2003, Oracle und MySQL, IT - Informatik. Pearson Studium, München.
  • Häckelmann, Heiko. (2013). Kommunikationssysteme: Technik und Anwendungen. Springer
  • Kemper, A. / Eickler, A. (2013): Datenbanksysteme: eine Einführung, 9., erweiterte und aktualisierte Auflage. ed. Oldenbourg verlag, München
Modul 12 Urbane Mobilität (UMOB)
German / kMod
6.00
-
Städtisches Mobilitätsmanagement (SMM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Ausgehend von städtischen verkehrspolitischen Zielsetzungen werden die Instrumente und Herangehensweisen erarbeitet, mit denen die Zielsetzungen erreicht werden können. Augenmerk liegt auf den Handlungsspielräumen der einzelnen Stakeholdern in der Entscheidungshierarchie.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Top-Down Ansätze zu verfolgen um geeignete Maßnahmen und Kombinationen aus Maßnahmen zu verkehrspolitischen Zielsetzungen zu beschreiben
  • Die Wirkung von Mobilitätsmaßnahmen zu beurteilen, um diese als Instrument in der urbanen Verkehrssteuerung gezielt einsetzen zu können
  • Die Wechselwirkung von Maßnahmen und Maßnahmenbündeln beurteilen zu können um effektive Maßnahmenbündel zu beschreiben
  • Die Rolle der Stakeholder in den einzelnen hierarchischen Niveaus der Verkehrspolitik und deren Umsetzung zu analysieren und zu beschreiben
  • Verkehrspolitische Ziele zu analysieren sowie deren Umsetzungsqualität zu beurteilen

Lehrinhalte

  • Hierarchisches Multi-Layer Modell „Politik – Taktik – Maßnahme – Betrieb“
  • Rollen und Verhalten der Akteure im urbanen Mobilitätsmanagement
  • Verkehrspolitische Zielsetzungen und deren Erreichung
  • Bildung von Szenarien als Instrument zur Mobilitätsbeeinflussung
  • Maßnahmen zur Mobilitätsbeeinflussung, deren Wirkung sowie deren Abhängigkeiten in einem Maßnahmen-Mix
  • Die Rolle der Technologie sowie von zukünftigen Anwendungen wie C-ITS
  • Bewertung Wirkung, Zielerreichung und Umsetzungsqualität von Maßnahmen

Vorkenntnisse

keine

Literatur

  • Adamski A., Kwasniak A. (2007): ITS – Hierarchical Multi-Layer System Traffic Safety Option, ITS ILS 2007, ISBN 978-83-88309-86-1
  • Dix, Michelle (2002): The Central London Congestion Charging Scheme – From Conception to Implementation. IMPRINT-EUROPE Thematic Network Seminar, Brussels
  • Europäische Kommission (2013): IVS-Expertengruppe für Urbane Bereiche, Guidlines for ITS deployment in Urban Areas
  • Europäische Kommission (2013): Best Practices in Urban ITS -Collection of Projects
  • ISIS, PWC (2010): Study on Urban Access Restrictions
  • Jesty P., Giezen J., Gaillet J., Durand J., Avontuur V., Bossom R., Franco G., KAREN – European ITS Framework Architecture, Models of Intelligent Transport Systems, KAREN TR 4108, Document Nr. D3.7
  • KU Leuven (2013): UITP, Study on Harmonised Collection of European Data and Statistics in the Field of Urban Transport and Mobility, 2013
  • Leihs, D. (2013): Key Performance Indicators as a Decision Support for Urban Traffic Planning, European ITS Conference Dublin, Ireland, TP0090
  • Leihs, D., Siegl, T., Hartmann, M. (2014): Nutzen und Technologien von Systemen zum Steuern der Zufahrt in urbane Zonen Stadtmaut – Umweltzonen - Zonen mit begrenzter Zufahrt, Springer Vieweg, ISBN 978-3-658-03785-7
  • McLeod, Kenneth; Healy, Seamus (2006): A business management approach to transport – Some lessons learned from congestion charging in Edinburgh. In: European Transport Conference
  • Purd’Homme, Remy; Bocarejo, Juan Pablo. (2005): The London congestion charge: a tentative economic appraisal. In: Transport Policy, Volume 12 Nr.3, S. 279-287
  • Rupprecht Consult GmbH (2012): Leitfaden für nachhaltige urbane Verkehrsplanung
  • Rupprecht Consult GmbH (20013): Pläne für die Nachhaltige urbane Mobilität
  • Siegl, T., Leihs, D., Trapuzzano, A. (2012): Eco Traffic Management in Cities, ITS World Congress Vienna, EU00636
Urbanes Verkehrsaufkommen (UVA)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung gibt einenen Überblick zu den Themen Smart city und motorisierter Verkehr. Dies beinhaltet planerische Aspekte beim motorisierten Individualverkehr und öffentlichen Verkehr, die Diskussion von Auswirkungen und die Beurteilung von Maßnahmen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Grundsätze und Einflussgrößen für die Anwendungsbereiche von Telematik im ÖPNV zu erläutern
  • die Grundlagen, die für die Anwendung im System ÖPNV relevant sind zu beschreiben und deren Relevanz für die Planung zu nennen.
  • mögliche Auswirkungen auf das Gesamtsystem hervorgerufen durch Veränderungen im Verkehrssystem (z.B. durch Einführung einer neuen Verkehrstechnologie oder Straßenbenützungsabgabe) zu erkennen und grob zu analysieren.
  • Möglichkeiten zur Steuerung des ruhenden Verkehrs zu erläutern
  • wesentliche Umweltwirkungen von Straßen(-verkehr) zu benennen
  • Kapazitäten der Verkehrsinfrastruktur baschätzen zu können

Lehrinhalte

  • Betriebliche Grundlagen im ÖPNV
  • Steuerung und Überwachung von ÖPNV-Systemen
  • Fahrgastinformation im ÖPNV
  • Verkehrsinformationssysteme
  • Intermodalität
  • Verkehrswirtschaft
  • Umweltauswirkungen von Verkehr
  • Beurteilung von Verkehrsinfrastrukturprojekten (im Sinne der Nachhaltigkeit) Verkehrsleit- und Informationssysteme
  • Stellplatzmanagement

Vorkenntnisse

Bachelor im Bereich Verkehr/Mobilität oder Ausgleichsmodul Lehrveranstaltung Grundlagen des Verkehrswesens

Leistungsbeurteilung

  • begleitende Übungen in Kleingruppen
  • schriftliche Prüfung
Modul 13 Wahlmodul 1 (WMOD1)
German / kMod
6.00
-
Modul 13a AK1 - Urbaner Gebäudebestand (AK13a)
German / kMod
6.00
-
Energetische Quartierssanierung (AK1EQS)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Grundlagen in der räumlichen und energetischen Analyse von urbanen Quartieren; Einflussfaktoren der Rahmenbedingungen auf den Energieverbrauch; Methodische Ansätze zur Erstellung von energetischen Sanierungskonzepten im urbanen Raum

Methodik

Integrierte LV, Vorträge, Gruppenarbeit

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Sanierungspotentiale im Gebäudebestand zu analysieren
  • Energetische Sanierungsvarianten für die Quartierssanierung zu definieren

Lehrinhalte

  • Bedarfsanalysen des Gebäudebestands
  • Energierelevante Maßnahmenbündel für unterschiedliche Gebäudetypologien
  • Sanierungskonzepte für Quartiere

Vorkenntnisse

Grundlagen und Definition von Smart City Einflussfaktoren Team-Work Kompetenzen Grundlagen des wissenschaftlichen Arbeitens

Literatur

  • Literatur / Referenzen werden in den Unterrichtseinheiten zur Verfügung gestellt

Leistungsbeurteilung

  • 50% Gruppenarbeit / 50% Abschlussprüfung
Nachverdichtung im urbanen Raum (AK1NUR)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Integrative Stadtentwicklung im Sinne einer Smart City funktioniert nur in einer sinnvollen Kombination zwischen planerischen Konzepten und technischen Lösungen. Ein stadtplanerisches Konzept stellt die Nachverdichtung urbaner Strukturen dar. Die bereits gebaute Stadt bietet in baulich-räumlicher Sicht große Potentiale zur Energieeinsparung. Wie diese Potentiale durch strategische Konzepte, konkrete Umsetzungsansätze und passend auf den jeweiligen Stadtraum erfolgreich umgesetzt werden kann, wird in dieser Lehrveranstaltung behandelt. Besonderes Augenmerk wird auf die vorhandenen städtebaulichen Strukturen und die energiesparende Quartiersplanung an sich gelegt. Es werden bestehende Stadtmorphologien verglichen und bestehende Konzepte zur Nachverdichtung behandelt sowie eigene Gedanken dazu formuliert.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Einflussfaktoren der Stadtmorphologie auf den urbanen Energieverbrauch zu beschreiben
  • Nachverdichtungskonzepte im urbanen Raum zu vergleichen und ein eigenes Konzept zu erstellen

Lehrinhalte

  • Auswirkung der Stadtmorphologie auf den urbanen Energieverbrauch
  • Gebäudetypologien im urbanen Kontext
  • Zielsetzungen und Maßnahmen zur Nachverdichtung

Vorkenntnisse

keine

Leistungsbeurteilung

  • Literaturstudium und anschließende Präsentation in der Lehrveranstaltung
  • Seminarabschlussarbeit

Anmerkungen

Die zu erbringenden Leistungen werden in Gruppenarbeit erstellt.

Modul 13b AK1 - Trends der urbanen Energieversorgung (AK13b)
German / iMod
6.00
-
Trends der urbanen Energieversorgung (AK1TUE)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung baut auf die Grundlagenvorlesung der urbanen Energieversorgung auf und vertieft Inhalte in den Bereichen der urbanen, erneuerbaren Energietechnologien und Energieversorgung von Gebäuden und Stadtquartieren. Erweiternd wird auf regulatorische Rahmenbedingungen, Wirtschaftlichkeitsaspekte und Lebenszykusbetrachtungen, sowie auf Fragestellungen der sozialen Akzeptanz eingegangen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • ein ganzheitliches Verständnis für energierelevante Fragestellungen im städtischen Raum zu entwickeln und anhand von beispielhaften Projekten umzusetzen
  • neue Technologieentwicklungen und veränderte Rahmenbedingungen in Bezug auf deren Auswirkungen in städtischen Strukturen zu bewerten
  • Gesellschaftliche und soziale Aspekte in zukünftigen Energiesystemen zu bewerten und die Anforderungen unterschiedlicher Interessensgruppen entsprechend einzuordnen
  • Wirtschaftlichkeits- und Lebenszyklusbetrachtungen von ausgewählten Energie-Projekten durchzuführen

Lehrinhalte

  • Strategien und Trends der städtischen Energieversorgung
  • Herausforderungen beim Umbau zu einer erneuerbaren städtischen Energieversorgung
  • Rechtliche und regulatorische Rahmenbedingungen
  • Wirtschaftlichkeits- und Lebenszyklusbetrachtungen von ausgewählten Projekten
  • Fragestellungen der sozialen Akzeptanz und Diversitätsaspekte

Vorkenntnisse

Grundlagen der urbanen Energieversorgung

Literatur

  • Cave / Cochrane, et.al. (2014), Mapping Smart Cities in the EU
  • Droege (2011): Urban Energy Transition: From Fossil Fuels to Renewable Power, Elsevier Verlag
  • Morata / Sandoval (2012): European Energy Policy: An Environmental Approach, Edward Elgar Publishing
  • Tagungsband Smart City Week 2015

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Abschlussprüfung
Modul 13c AK1 - Physikalische Messtechnik (AK13c)
German / iMod
6.00
-
Physikalische Messtechnik für Smart Cities (AK1PMT)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung zeigt Möglichkeiten der Messung physikalischer Größen, die im Smart City Umfeld benötigt werden.

Methodik

Vorlesung mit integrierten Übungsanteilen, Labor und Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Messgrößen, die in der Smart-Cities-Thematik von besonderer Bedeutung sind, physikalisch und statistisch korrekt aufzunehmen
  • Messwerte statistisch korrekt zu verarbeiten und auszuwerten. in gegebenen praktischen Situationen geeignete Messmethoden auszuwählen und diese anzuwenden
  • die Bedeutung von Messfehlern und deren Auswirkungen zu beurteilen
  • Messfehler für physikalische Messgrößen aus Toleranzen von Messgeräten zu bestimmen

Lehrinhalte

  • Struktur einer Messeinrichtung
  • Systematische und statistische Messfehler
  • Fehlerfortpflanzung
  • Messverfahren für Temperatur
  • Messverfahren für Energie
  • Messverfahren für Leistung
  • Messverfahren für Wärmemengen
  • Messverfahren für Umweltgrößen
  • Messverfahren für Licht
  • Auswerte-Methoden für Messgrößen

Vorkenntnisse

Grundlagen der Physik und Elektrotechnik

Literatur

  • Kunze, H.J. (1986): Physikalische Messmethoden, Teubner
  • Lerch, R. (2007): Elektrische Messtechnik: Analoge, digitale und computergestütze Verfahre, Springer
  • Lindner, G. / Niebuhr, J (2001): Physikalische Messtechnik mit Sensoren, Oldenbourg
  • Versuchsanleitungen
Modul 13d AK1 - Embedded Systems (AK13d)
German / iMod
6.00
-
Embedded Systems (AK1ES)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Einführung in das hardwarenahe Programmieren von Mikrocontrollern.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Eigenschaften und Besonderheiten von Embedded Systems zu beschreiben
  • eine Integrierte Entwicklungsumgebung für das Programmieren und Debuggen von Embedded Systems Software einzusetzen
  • hardwarenahe modulare Software in C für Embedded Systems zu entwerfen und zu schreiben
  • typische Peripherieeinheiten eines Mikrocontrollers für die Anbindung von Sensoren und Aktoren einzusetzen

Lehrinhalte

  • Aufbau, Eigenschaften und Besonderheiten von Embedded Systems
  • Aufbau und Funktion von Mikrocontrollern
  • Arbeiten mit einer Integrierten Entwicklungsumgebung für Mikrocontroller
  • Debugging von Embedded Systems Software
  • Softwareentwurf in C für Embedded Systems, modulare Software
  • Zugriff auf I/O-Ports, Bit-Manipulation in C
  • Behandlung von Ereignissen in Interrupt Service Routinen
  • Timer/Counter-Einheit
  • Serielle digitale Interfaces (z.B. RS232, SPI, I2C)
  • weitere Peripherieeinheiten (z.B. ADC, PWM, DMA, ...)
  • Projektarbeit

Vorkenntnisse

Programmiersprache C

Literatur

  • Skriptum C167, C167 User Manual, Studienbriefe, Simulationstool
  • Valvano, J. (2012): Embedded Systems: Introduction to Arm Cortex-M Microcontrollers, CreateSpace Independent Publishing Platform; 5th edition
  • White, E. (2011): Making Embedded Systems: Design Patterns for Great Software, O'Reilly Media; 1st edition

Leistungsbeurteilung

  • schriftlicher Test, Projektarbeit im Team
Modul 13e AK1 - Human Factors in der Mobilität (AK13e)
German / kMod
6.00
-
Faktor Mensch in der Mobilität (AK1HUM)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Diese Vorlesung befasst sich mit den menschlichen Faktoren, die das Mobilitätsverhalten der VerkehrsteilnehmerInnen beeinflussen. Daraus werden Kenntnisse über verschiedene Ansätze zur besseren Nutzung der Stadtinfrastruktur und Transportsysteme gewonnen. Ebenso werden die Auswirkungen der Einführung neuer Technologien im Fahrerverhalten berücksichtigt.

Methodik

Vorlesung mit integrierten Übungsanteilen, Gruppenarbeit und Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • menschliche Faktoren, die den Verkehr beeinflussen, zu beschreiben
  • Mobilitätsprobleme zu analysieren und potentielle Lösungen vorzuschlagen
  • Faktoren, die menschliche Mobilität beeinflussen, zu spezifizieren
  • Methoden zur Datenerfassung und -verarbeitung auf der Grundlage geeigneter Technologien und des spezifischen Anwendungsfalles zu entwerfen

Lehrinhalte

  • Menschliche Faktoren, die Intelligente Verkehrssysteme beeinflussen
  • Methoden, die menschlichen Faktoren für eine intelligente Mobilität berücksichtigen.
  • Faktoren, die die Mobilität der Menschen beeinflussen

Vorkenntnisse

Grundlagen des Verkehrswesens

Literatur

  • Understanding individual human mobility patterns, MC Gonzalez, CA Hidalgo, AL Barabasi, Nature 453 (7196), 779-782
  • The ‘Roadmap to a Single European Transport Area - Towards a competitive and resource efficient transport system’, http://ec.europa.eu/transport/strategies/2011_white_paper_en.htm
  • The Human Factors of Transport Signs, edited by Candida Castro,Tim Horberry https://books.google.at/books?id=iFCZ53i5XXgC&printsec=frontcover&dq=human+factors+in+transport&hl=de&sa=X&ved=0ahUKEwiN5ov-vdfOAhVBaRQKHSEtAOYQ6AEIODAA#v=onepage&q=human%20factors%20in%20transport&f=false
  • Human Factors in Intelligent Transportation Systems, Woodrow Barfield, ‎Thomas A. Dingus – 2014; https://books.google.at/books?isbn=1317781104

Leistungsbeurteilung

  • Präsentationen, Gruppenarbeit, Prüfung
Verkehrssicherheit (AK1VSICH)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung soll einen Überblick über die Grundlagen der Straßenverkehrssicherheitsarbeit vermitteln. Darauf aufbauend werden mit den Studierenden anhand zahlreicher praktischer Beispiele konkrete Maßnahmen und deren Wirkungen diskutiert.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Wirkung von (vorrangig technischen) Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt grob abzuschätzen
  • Forschungsmethoden aufzuzählen und zu erklären, die für die genaue Feststellung der Wirkungen von Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt zur Verfügung stehen
  • Datenquellen aufzuzählen und zu erklären, die bei der Feststellung der Wirkung von Maßnahmen im Straßenverkehr auf Sicherheit und Umwelt benutzt werden können
  • verschiedene Methoden der Priorisierung von Maßnahmen zu nennen und deren Vor- und Nachteile zu beschreiben
  • typische Verhaltensweisen von Menschen im Straßenverkehr aufzuzählen und zu erläutern, anhand derer der Umgang von Verkehrsteilnehmern mit unterschiedlichen Maßnahmen erklärt werden kann
  • für Teilbereiche der Verkehrssicherheitsarbeit (z.B. für Verkehrsteilnehmergruppen) vertieft spezifische Probleme zu identifizieren und Maßnahmen vorzuschlagen

Lehrinhalte

  • Überblick über das Verkehrsgeschehen in Österreich und auf Europäischer Ebene
  • Quantifizierung des Unfallgeschehens: Datenerfassung, Datenspeicherung, Datenauswertung
  • Aspekte des Verhaltens von Verkehrsteilnehmern
  • Methoden der Verhaltensforschung bei Verkehrsteilnehmern
  • Datenquellen für Sicherheits-, Verkehrs- und Umweltdaten
  • Methoden der Priorisierung von Maßnahmen auf integrierter Basis von Sicherheits-, Verkehrs- und Umweltdaten

Vorkenntnisse

keine erforderlich

Literatur

  • Elvik, R. / Hoye, A. / Vaa, T. / Sorensen, M. (2009): The Handbook of Road Safety Measures, 2nd Edition, Emerald Publishing Group Limited, ISBN 978-1-84855-250-0
  • European Road Safety Observatory www.erso.eu
  • Herry et al (2007): Unfallkostenrechnung Straße 2007, Forschungsarbeiten aus dem Verkehrswesen Band 177, Bundesministerium für Verkehr, Innovation und Technologie, Wien
  • Höhnscheid et al (2005): ROSEBUD: Framework for Efficiency Assessment, Handbook of Assessed Road Safety Measures; Demonstration Course, Bergisch-Gladbach. www.rosebud-eu.org.
  • OECD/ECMT (2006): Speed Management. ISBN 92-821-0377-3 Robatsch, K. / Schrammel, E. (2001): Grundlagen der Verkehrssicherheit. IVS-Schriftenreihe, Band 13. TU-Wien
  • SUPREME Final Report Part C: Handbook For Measures At The Country Level, KFV, 2007
  • SUPREME Final Report Part D: Handbook For Measures At The European Level

Leistungsbeurteilung

  • schriftliche Prüfung
  • eine schriftliche Seminararbeit
  • sowie LV-immanent (aktive Mitarbeit)
Modul 13f AK1 - Treibhausgasreduktion (AK13f)
German / iMod
6.00
-
Treibhausgasreduktion (AK1THGR)
German / ILV, FL
6.00
4.00

Kurzbeschreibung

Die Lehrveranstaltung zegt die Arten und Ansätze zur Vermeidung von Treibhausgasen, es wird auch auf die rechtlichen Aspekte eingegangen.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • die Quellen von Treibhausgasen in Städten mit Hinblick auf ihr Emissionsverhalten zu beurteilen
  • die Interdependenzen unterschiedlicher Emissionsquellen zu bewerten
  • die Maßnahmen zur Verringerung von Treibhausgasen zu beurteilen
  • die nationalen Verpflichtungen zum Erreichen von Emissionszielen mit Hinblick auf supranationale, nationale und regionale Maßnahmen zu bewerten

Lehrinhalte

  • Wirkung und Arten von Treibhausgasen
  • Internationale Vereinbarungen und Bestrebungen zur THG-Verringerung
  • Quellen von Treibhausgasen sowie deren Trend
  • Lokale Maßnahmen zum Verringern von Treibhausgasen in Städten, insbesondere Heizung, industrielle Prozesse und Mobilität
  • Interdependenz von Maßnahmen zur THG-Verringerung

Vorkenntnisse

keine

Literatur

  • Climate Change 2013, The Physical Science Basis, Cambridge University Press
  • Europäische Kommission (2014): Klimaschutz, ISBN 978-92-79-41340-7
  • Europäische Kommission (2014): Conclusion EUCO 169/14
  • Europäische Kommission (2013): The EU Emission Trading System (EU ETS), 2013
  • European Commission (2012): Richtlinie des Europäischen Parlamentes und des Rates, Nr. 2012/27/EU („Energieeffizienzrichtlinie“)
  • Europäische Kommission (2011): Weissbuch - Fahrplan zu einem einheitlichen europäischen Verkehrsraum – Hin zu einem wettbewerbsorientierten und ressourcenschonenden Verkehrssystem: KOM(2011) 144 endgültig
  • KU Leuven, UITP (2013): Study on Harmonised Collection of European Data and Statistics in the Field of Urban TraCnsport and Mobility
  • Umweltbundesamt (21013):Klimaschutzbericht 2013
  • Umweltbundesamt (2015): GHG Projections and Assessment of Policies and Measures in Austria, 2015
  • UN (2014): UN Climate Summit 2014, Cities Mayors Compact Action Statement
  • UN (1998): UN Kyoto Protocol to the United Nations Framework Convention on Climate Change
Modul 14 Projekt 1 (PRJ1)
German / kMod
6.00
-
Interdisziplinäre Teamarbeit (ITEAM)
German / SE
3.00
2.00

Kurzbeschreibung

Die Lehrveranstaltung vermittelt den Studierenden theoretische Kenntnisse zur interdisziplinären Teamarbeit und bereitet sie darauf vor diese im beruflichen Kontext umzusetzen. Die persönliche Reflexion, das Behandeln von Fallbeispielen und das Üben von Verhaltensmöglichkeiten stehen im Mittelpunkt.

Methodik

Vorlesung mit integrierten Übungsanteilen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Kommunikationsverhalten in interdisziplinären Gesprächen anhand theoretischer Erkenntnisse (z.B. unterschiedliche Überzeugungen, Hierarchien und Professionszentrismus) zu beschreiben und zu erläutern.
  • konkrete Verhaltensalternativen für eine erfolgreiche Zusammenarbeit in interdisziplinären Teams (z.B. Perspektivenwechsel, Sprachanpassung, mediatorische Gesprächsführung) fallbezogen zu entwickeln und in einfachen Übungen anzuwenden
  • Arten, Ursachen und die verschiedenen Stufen eines Konfliktes insbesondere in einem interdisziplinären Kontext (z. B. nach dem Eskalationsmodell von Glasl) zu beschreiben und Instrumente der Deeskalation (z. B. Selbsthilfe, Moderation) anzuwenden.

Lehrinhalte

  • Multi-, Inter- und Transdisziplinarität
  • Herausforderungen in der interdisziplinären Teamarbeit
  • Kriterien und Kompetenzen für erfolgreiche interdisziplinäre Teamarbeit
  • Identität und Selbstkonzept
  • Überblick zu Theorien der Gruppendynamik
  • Kommunikation und Gesprächsführung
  • Grundlagen zur konstruktiven Gestaltung von Konfliktsituationen

Vorkenntnisse

keine

Literatur

  • Glasl, Friedrich (2008): Selbsthilfe in Konflikten, 5. Auflage, Stuttgart: Verlag Freies Geistesleben/Haupt
  • Haeske, U. (2008): Teamentwicklung, Berlin: Cornelsen Verlag, [bilingual book: in English and German]
  • Simon, Walter (2007): GABALs großer Methodenkoffer: Grundlagen der Kommunikation, Offenbach: Gabal Verlag
  • weitere Literatur zu interdisziplinären Teams

Leistungsbeurteilung

  • LV-Immanente Leistungsbeurteilung und Prüfung (Note)

Anmerkungen

keine

Projektarbeit 1 (PRJ1)
German / PRJ
3.00
2.00

Kurzbeschreibung

Analyse und Spezifikation eines Projekts im (interdisziplinären) Smart City Umfeld

Methodik

Projektseminar

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • anhand einer Problemstellung einen State of the art Bericht zu erstellen und eine Marktanalyse durchzuführen
  • Anwendungsszenarien und funktionale Anforderungen zu definieren
  • Vision, Beschreibung, Ziele und Projektumfeld zu formulieren und eine erste Version eines Projekthandbuches zu erstellen
  • Resultate in Form eines wissenschaftlichen Papers darzustellen

Lehrinhalte

  • Umsetzung von Projekten in Teamarbeit (nach Möglichkeit mit einer interdisziplinären Teamzusammenstellung)
  • Führen eines Projekthandbuchs
  • State of the art Analyse (wissenschaftlich, technisch)
  • Marktanalyse
  • Definition von Anwendungsszenarien (inklusive organisatorischer Rahmenbedingungen)
  • Funktionale Anforderungen
  • Projektmanagement

Vorkenntnisse

Grundlegendes Verständnis von Projektmanagement, technische Vorkenntnisse je nach Projektthema

Literatur

  • Abhängig vom Projektthema

Leistungsbeurteilung

  • LV-Immanent, Documentation, Präsentationen, Paper
Modul 15 Smart City Perspektive (SCP)
German / kMod
6.00
-
Smart City Trends (SCT)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Es wird der Zusammenhang von Smart-City-Konzepten, den hierbei entstehenden Berufsfeldern und den künftig dafür notwendigen Kernaufgaben und Kerntätigkeiten erläutert. Berufliche Kernkompetenzen für die beruflichen Positionen und Funktionen zur Ermöglichung einer integrativen Stadtentwicklung werden anhand des Smart City Konzeptes schriftlich mit den Studierenden ausgearbeitet und beurteilt.

Methodik

Vorlesung mit integrierten Übungsanteilen

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • unterschiedliche Smart-City-Konzepte darlegen und auf ihre sozio-technologische Ausgewogenheit hin einordnen zu können
  • einen Überblick über die Berufsfelder im Kontext des Smart City Ansatzes darlegen und auf ihre künftigen Entwicklungen hin analysieren zu können
  • Kernkompetenzen integrativer Stadtentwicklung zu definieren und auf horizontale Schnittstellenanforderungen zu übertragen
  • Berufsbilder für Positionen und Funktionen im Kontext eines Smart City Konzeptes schriftlich ausarbeiten zu können

Lehrinhalte

  • Konzepte des Smart City Ansatzes sowie urbane Systemarchitekturen
  • Berufsfeldmodelle zur Analyse beruflicher Smart City Trends
  • Berufsfelder im Rahmen von Smart City mit dem integrativen Fokus von Mobilität – Energie - IKT
  • integrative Kernkompetenzen für den Aufbau bzw. die Stabilisierung von Smart-City-Projekten
  • Ausarbeitung bzw. Adaption von (bestehenden) Berufsbildern/ Stellenprofilen hin zur Weiterentwicklung von Smart-City-affinen Tätigkeitsfeldern (Arbeitsplätzen)

Vorkenntnisse

keine

Literatur

  • Guenter Essl (2015). The ‘profession/ occupation field model’ as an activity theoretical framework for the development of engineers in the context of the Smart City approach. http://authors.elsevier.com/sd/article/S1877042815047515
  • Etezadzadeh (2015). Smart City - Stadt der Zukunft? - Die Smart City 2.0 als lebenswerte Stadt und Zukunftsmarkt (essentials). (1st ed.): Springer Vieweg
  • Jaekel, M. (2015). Smart City wird Realität. (1. Aufl. 2015): Springer Vieweg.
  • Stögerer, M., Müller, J., & Jutz, K. (2015). Smart City. Kritische Analyse des Konzepts: Grin Verlag.
  • Stroschein, C. (Ed.) (2014). Smart City: Die Zukunft der Stadt Trends und Entwicklungen. (1., Aufl.): Beuth.

Leistungsbeurteilung

  • Additive Aufgabenstellungen über das Gesamtsemester hinweg
Stadtprozesse (SPZ)
German / ILV, FL
3.00
2.00

Kurzbeschreibung

Ausgehend von einer Einführung in das Standortproblem werden unterschiedliche theoretische Ansätze angerissen. Zum einen solche, die die Transportkosten in den Vordergrund stellen (neoklassische), zum anderen auch jüngere Ansätze, die stärker die Rolle von Arbeitskräften, Information sowie von Organisation und Technologie betonen. Das Zusammenwirken von beteiligten Akteuren wird beleuchtet, zusätzlich werden die Strukturen der Bodennutzung innerhalb von Städten als auch das gesamte städtische System beleuchtet. Es erfolgt eine Darstellung der organisatorischen, rechtlichen und technischen Rahmenbedingungen der elektronischen Wechselwirkung zwischen Behörden einerseits und Unternehmen bzw. Bürgern andererseits.

Methodik

Vorlesung mit integrierten Übungsanteilen, Fernlehrunterstützung

Lernergebnisse

Nach erfolgreichem Abschluss sind die Studierenden in der Lage, ...

  • Grundlegende Prinzipien nachhaltiger Stadtökonomie erklären und diskutieren
  • Prinzipien und Strategie des österreichischen E-Government benennen
  • Einflussfaktoren auf die Standortwahl identifizieren und quantifizieren
  • Stakeholder und ihre Interessen analysieren

Lehrinhalte

  • Grundlagen der Stadtökonomie: Bildung, Sicherheit, Wohnungsmarkt, Nutzbarkeit des öffentlichen Raums, Umweltschutz
  • Urban Governance: Stadtpolitik, Bürgerrechte, Verwaltungsökonomie
  • E-Government, Prozesse und Realisierungen
  • Städtische Stakeholderprozesse

Vorkenntnisse

keine

Literatur

  • Amey, F. / Ringel, J. (2014): Hotspots der Stadtentwicklung: Methoden, Praxis und Perspektiven der gemanagten Stadt
  • Hentze, J. / Thies, B. (2014): Stakeholder-Management und Nachhaltigkeits-Reporting
  • Plattform Digitales Österreich, https://www.digitales.oesterreich.gv.at
  • Ruby, I. / Ruby, A. (2014): The Economy of Sustainable Construction, Ruby Press
  • Van Der Heijden, J. (2014): Governance for Urban Sustainability and Resilience: Responding to Climate Change and the Relevance of the Built Environment, Edward Elgar Publishing Ltd
  • Maier, G./Tödtling, F. (2006): Regional- und Stadtökonomik

Leistungsbeurteilung

  • LV-immanente Leistungsbeurteilung (Ausarbeitung und Präsentation)

2. Semester

Bezeichnung ECTS
SWS
Modul 21 Urbane Erneuerbare Energie (AMOD)
German / kMod
6.00
-
Energieinfrastruktur (EINF)
German / ILV, FL
3.00
2.00
Energieversorgung von Gebäuden und Quartieren (EGQ)
German / ILV, FL
3.00
2.00
Modul 22 IKT (AMOD)
German / kMod
6.00
-
Datenanalyse (DATA)
German / ILV, FL
3.00
2.00
Smart Data (SMD)
German / ILV, FL
3.00
2.00
Modul 23 Wahlmodul 2 (WMOD2)
German / kMod
6.00
-
Modul 23a AK2 - Urbane Logistik (AK23a)
German / kMod
6.00
-
Technische Logistik und Flottenmanagement (AK2TLOG)
German / ILV, FL
3.00
2.00
Urbane Logistik (AK2ULOG)
German / ILV, FL
3.00
2.00
Modul 23b AK2 - Elektromobilität (AK23b)
German / iMod
6.00
-
Aktuelle Themen der Elektromobilität (AK2ELMOB)
German / ILV, FL
6.00
4.00
Modul 23c AK2 - Sensorik und Regelungstechnik (AK23c)
German / kMod
6.00
-
Regelungstechnik (AK2REG)
German / ILV, FL
3.00
2.00
Sensorik (AK2SEN)
German / ILV, FL
3.00
2.00
Modul 23d AK2 - Verteilte und Zuverlässige Systeme (AK23d)
German / iMod
6.00
-
Verteilte und Zuverlässige Systeme (AK2VSYS)
German / ILV, FL
6.00
4.00
Modul 23e AK2 - Urbane Beleuchtung (AK23e)
German / iMod
6.00
-
Lichttechnologien für urbane Beleuchtung (AK2LICHT)
German / ILV, FL
6.00
4.00
Modul 23f AK2 - Bildverarbeitung (AK23f)
German / iMod
6.00
-
Anwendungsorientierte Bildverarbeitungstechnologien (AK2BILD)
German / ILV, FL
6.00
4.00
Modul 24 Projekt 2 (PRJ2)
German / iMod
6.00
-
Projektarbeit 2 (PRJ2)
German / PRJ
6.00
4.00
Modul 25 Unternehmenskooperation (UKO)
German / kMod
6.00
-
Internationale Smart City Dimensionen (ISCD)
German / ILV, FL
3.00
2.00
Organisationsentwicklung und Change Management (OECM)
German / ILV, FL
3.00
2.00

3. Semester

Bezeichnung ECTS
SWS
Modul 31 Stadtplanung (SPL)
German / kMod
6.00
-
Integrative Stadtplanung (ISPL)
German / ILV, FL
3.00
2.00
Kritische Infrastrukturen (KINF)
German / ILV, FL
3.00
2.00
Modul 32 Simulation (SIM)
German / kMod
6.00
-
GIS (GIS)
German / ILV, FL
3.00
2.00
Simulation (SIM)
German / ILV, FL
3.00
2.00
Modul 33 Wahlmodul 3 (WMOD3)
German / kMod
6.00
-
Modul 33a AK3 - IT Sicherheit in Energie und Mobilität (AK33a)
German / iMod
6.00
-
IT Sicherheit in Energie und Mobilität (AK3ITSEC)
German / ILV, FL
6.00
4.00
Modul 33b AK3 - Smart Healthcare (AK33b)
German / kMod
6.00
-
Crowd Sourced Healthcare in Smart Cities (AK3HEALTH)
German / ILV, FL
3.00
2.00
Integration und Nutzung vernetzter medizinischer IT Infrastrukturen (AK3MED)
German / ILV, FL
3.00
2.00
Modul 33c AK3 - Big Data (AK33c)
German / kMod
6.00
-
Semantische Wissensrepräsentation und Linked Data (AK3SEM)
German / ILV, FL
3.00
2.00
Technische Konzepte Big Data (AK3TBD)
German / ILV, FL
3.00
2.00
Modul 33d AK3 - Autonomes Fahren (AK33d)
German / iMod
6.00
-
Autonomes Fahren (AK3AUTF)
German / ILV, FL
6.00
4.00
Modul 33e AK3 - Kooperative Systeme (AK33e)
German / iMod
6.00
-
Kooperative und vernetzte Systeme (AK3KOPS)
German / ILV, FL
6.00
4.00
Modul 34 Spezialisierung (WMOD3)
German / kMod
6.00
-
Spezialisierung (SPEZ)
German / SE
3.00
2.00
Wissenschaftliches Arbeiten (WIA)
German / SE
3.00
2.00
Modul 35 Wirtschaft (WMOD3)
German / kMod
6.00
-
Ausschreibungen und Innovationsmanagement (INNO)
German / ILV, FL
3.00
2.00
Smart City Geschäftsmodelle (SCGM)
German / ILV, FL
3.00
2.00

4. Semester

Bezeichnung ECTS
SWS
Modul 41 Mastermodul (MSC)
German / kMod
30.00
-
Diplomandenseminar (DIPL)
German / SE
3.00
2.00
Master Thesis (MT)
German / BE
24.00
0.00
Scientific Writing (SCW)
English / SE
3.00
2.00